Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|730750
Gene name
Locationscaffold_10:614391..617027
Strand+
Gene length (bp)2636
Transcript length (bp)2514
Coding sequence length (bp)2514
Protein length (aa) 838

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 1.1E-54 489 829
PF02265 S1-P1_nuclease S1/P1 Nuclease 7.3E-40 24 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36605|HIS8_SCHPO Histidinol-phosphate aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his3 PE=3 SV=1 428 837 2.0E-102
sp|P56099|HIS8_CANMA Histidinol-phosphate aminotransferase OS=Candida maltosa GN=HIS5 PE=3 SV=1 428 834 2.0E-97
sp|P07172|HIS8_YEAST Histidinol-phosphate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS5 PE=3 SV=2 428 822 3.0E-90
sp|Q11VM5|HIS8_CYTH3 Histidinol-phosphate aminotransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisC PE=3 SV=1 428 837 4.0E-70
sp|A6LAM2|HIS8_PARD8 Histidinol-phosphate aminotransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=hisC PE=3 SV=1 429 830 1.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36605|HIS8_SCHPO Histidinol-phosphate aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his3 PE=3 SV=1 428 837 2.0E-102
sp|P56099|HIS8_CANMA Histidinol-phosphate aminotransferase OS=Candida maltosa GN=HIS5 PE=3 SV=1 428 834 2.0E-97
sp|P07172|HIS8_YEAST Histidinol-phosphate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS5 PE=3 SV=2 428 822 3.0E-90
sp|Q11VM5|HIS8_CYTH3 Histidinol-phosphate aminotransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisC PE=3 SV=1 428 837 4.0E-70
sp|A6LAM2|HIS8_PARD8 Histidinol-phosphate aminotransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=hisC PE=3 SV=1 429 830 1.0E-60
sp|A5FFY0|HIS8_FLAJ1 Histidinol-phosphate aminotransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=hisC PE=3 SV=1 428 830 3.0E-60
sp|A0M287|HIS8_GRAFK Histidinol-phosphate aminotransferase OS=Gramella forsetii (strain KT0803) GN=hisC PE=3 SV=1 428 835 3.0E-59
sp|A6GY79|HIS8_FLAPJ Histidinol-phosphate aminotransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=hisC PE=3 SV=1 427 827 1.0E-58
sp|A6L2V8|HIS8_BACV8 Histidinol-phosphate aminotransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=hisC PE=3 SV=1 429 830 3.0E-55
sp|Q8ABA8|HIS8_BACTN Histidinol-phosphate aminotransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisC PE=3 SV=1 430 832 1.0E-52
sp|B1JPW1|HIS8_YERPY Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hisC PE=3 SV=1 429 831 2.0E-52
sp|A7FJH1|HIS8_YERP3 Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hisC PE=3 SV=1 429 831 2.0E-52
sp|Q64RE8|HIS8_BACFR Histidinol-phosphate aminotransferase OS=Bacteroides fragilis (strain YCH46) GN=hisC PE=3 SV=1 430 832 2.0E-52
sp|B2FPM0|HIS8_STRMK Histidinol-phosphate aminotransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=hisC PE=3 SV=1 429 826 3.0E-52
sp|Q5LAZ9|HIS8_BACFN Histidinol-phosphate aminotransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisC PE=3 SV=1 430 832 4.0E-52
sp|B4STN8|HIS8_STRM5 Histidinol-phosphate aminotransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hisC PE=3 SV=1 429 826 1.0E-51
sp|B0RSL5|HIS8_XANCB Histidinol-phosphate aminotransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=hisC PE=3 SV=1 429 827 4.0E-51
sp|A4TKK4|HIS8_YERPP Histidinol-phosphate aminotransferase OS=Yersinia pestis (strain Pestoides F) GN=hisC PE=3 SV=1 429 831 9.0E-51
sp|Q1CGX0|HIS8_YERPN Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hisC PE=3 SV=1 429 831 9.0E-51
sp|A9R2K5|HIS8_YERPG Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hisC PE=3 SV=1 429 831 9.0E-51
sp|Q8ZFX6|HIS8_YERPE Histidinol-phosphate aminotransferase OS=Yersinia pestis GN=hisC PE=3 SV=1 429 831 9.0E-51
sp|Q1C9R1|HIS8_YERPA Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hisC PE=3 SV=1 429 831 9.0E-51
sp|P58892|HIS8_XANCP Histidinol-phosphate aminotransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisC PE=3 SV=1 429 827 1.0E-50
sp|Q5QWQ9|HIS82_IDILO Histidinol-phosphate aminotransferase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisC2 PE=3 SV=1 430 834 1.0E-50
sp|Q66C50|HIS8_YERPS Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisC PE=3 SV=1 429 831 1.0E-50
sp|B2JZM8|HIS8_YERPB Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hisC PE=3 SV=1 429 831 1.0E-50
sp|P44423|HIS81_HAEIN Histidinol-phosphate aminotransferase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisC1 PE=3 SV=1 428 833 1.0E-50
sp|Q3BUF6|HIS8_XANC5 Histidinol-phosphate aminotransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisC PE=3 SV=1 429 832 2.0E-50
sp|A5UA19|HIS8_HAEIE Histidinol-phosphate aminotransferase OS=Haemophilus influenzae (strain PittEE) GN=hisC PE=3 SV=1 428 833 3.0E-50
sp|Q5H0L0|HIS8_XANOR Histidinol-phosphate aminotransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hisC PE=3 SV=2 429 832 3.0E-50
sp|Q2P3K2|HIS8_XANOM Histidinol-phosphate aminotransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hisC PE=3 SV=1 429 832 3.0E-50
sp|Q4QN73|HIS81_HAEI8 Histidinol-phosphate aminotransferase 1 OS=Haemophilus influenzae (strain 86-028NP) GN=hisC1 PE=3 SV=2 428 833 3.0E-50
sp|A5UGY2|HIS8_HAEIG Histidinol-phosphate aminotransferase OS=Haemophilus influenzae (strain PittGG) GN=hisC PE=3 SV=1 428 833 3.0E-50
sp|Q4UU41|HIS8_XANC8 Histidinol-phosphate aminotransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hisC PE=3 SV=1 429 827 3.0E-50
sp|Q492K2|HIS8_BLOPB Histidinol-phosphate aminotransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=hisC PE=3 SV=1 428 833 4.0E-50
sp|P58891|HIS8_XANAC Histidinol-phosphate aminotransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisC PE=3 SV=1 429 832 1.0E-49
sp|A8GC78|HIS8_SERP5 Histidinol-phosphate aminotransferase OS=Serratia proteamaculans (strain 568) GN=hisC PE=3 SV=1 428 833 2.0E-49
sp|Q7VQW9|HIS8_BLOFL Histidinol-phosphate aminotransferase OS=Blochmannia floridanus GN=hisC PE=3 SV=1 428 833 2.0E-49
sp|A1JTV9|HIS8_YERE8 Histidinol-phosphate aminotransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hisC PE=3 SV=1 429 831 2.0E-49
sp|Q84I51|HIS8_BUCSC Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=hisC PE=3 SV=1 429 833 1.0E-48
sp|Q9CLM3|HIS81_PASMU Histidinol-phosphate aminotransferase 1 OS=Pasteurella multocida (strain Pm70) GN=hisC1 PE=3 SV=1 428 833 2.0E-48
sp|Q89AX7|HIS8_BUCBP Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=hisC PE=3 SV=1 429 835 5.0E-48
sp|A7MJP4|HIS8_CROS8 Histidinol-phosphate aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hisC PE=3 SV=1 428 830 1.0E-47
sp|Q87C30|HIS8_XYLFT Histidinol-phosphate aminotransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisC PE=3 SV=1 423 822 5.0E-47
sp|B2I5Y0|HIS8_XYLF2 Histidinol-phosphate aminotransferase OS=Xylella fastidiosa (strain M23) GN=hisC PE=3 SV=1 423 822 5.0E-47
sp|B0U3B2|HIS8_XYLFM Histidinol-phosphate aminotransferase OS=Xylella fastidiosa (strain M12) GN=hisC PE=3 SV=1 429 822 5.0E-47
sp|Q7N6I1|HIS8_PHOLL Putative histidine biosynthesis bifunctional protein HisCD OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisCD PE=3 SV=1 377 833 1.0E-46
sp|Q15RU8|HIS8_PSEA6 Histidinol-phosphate aminotransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hisC PE=3 SV=1 430 834 1.0E-46
sp|Q9PBC6|HIS8_XYLFA Histidinol-phosphate aminotransferase OS=Xylella fastidiosa (strain 9a5c) GN=hisC PE=3 SV=1 429 822 2.0E-46
sp|A0KKB7|HIS8_AERHH Histidinol-phosphate aminotransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=hisC PE=3 SV=1 428 827 4.0E-46
sp|A6TBC4|HIS8_KLEP7 Histidinol-phosphate aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hisC PE=3 SV=1 428 830 5.0E-45
sp|Q84I52|HIS8_BUCMH Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Melaphis rhois GN=hisC PE=3 SV=1 429 833 2.0E-44
sp|Q84I53|HIS8_BUCDN Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=hisC PE=3 SV=1 435 837 4.0E-44
sp|Q6D410|HIS8_PECAS Histidinol-phosphate aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisC PE=3 SV=1 429 830 6.0E-44
sp|Q9ZHE5|HIS8_BUCAP Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisC PE=3 SV=1 429 830 1.0E-43
sp|A4SMP7|HIS8_AERS4 Histidinol-phosphate aminotransferase OS=Aeromonas salmonicida (strain A449) GN=hisC PE=3 SV=1 428 827 2.0E-43
sp|Q32EF0|HIS8_SHIDS Histidinol-phosphate aminotransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hisC PE=3 SV=1 429 830 3.0E-43
sp|A8A1P5|HIS8_ECOHS Histidinol-phosphate aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=hisC PE=3 SV=1 429 830 4.0E-43
sp|B7MDH5|HIS8_ECO45 Histidinol-phosphate aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hisC PE=3 SV=1 429 830 5.0E-43
sp|B5XPE6|HIS8_KLEP3 Histidinol-phosphate aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=hisC PE=3 SV=1 428 830 5.0E-43
sp|Q57MS2|HIS8_SALCH Histidinol-phosphate aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=hisC PE=3 SV=1 428 830 5.0E-43
sp|B5FM42|HIS8_SALDC Histidinol-phosphate aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=hisC PE=3 SV=1 428 830 8.0E-43
sp|C0Q1K1|HIS8_SALPC Histidinol-phosphate aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=hisC PE=3 SV=1 428 830 8.0E-43
sp|B4TMR6|HIS8_SALSV Histidinol-phosphate aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=hisC PE=3 SV=1 428 830 9.0E-43
sp|B5RBR3|HIS8_SALG2 Histidinol-phosphate aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=hisC PE=3 SV=1 428 830 9.0E-43
sp|B5QZL3|HIS8_SALEP Histidinol-phosphate aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=hisC PE=3 SV=1 428 830 9.0E-43
sp|B5EX40|HIS8_SALA4 Histidinol-phosphate aminotransferase OS=Salmonella agona (strain SL483) GN=hisC PE=3 SV=1 428 830 9.0E-43
sp|B7L9P8|HIS8_ECO55 Histidinol-phosphate aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=hisC PE=3 SV=1 429 830 1.0E-42
sp|B1LP20|HIS8_ECOSM Histidinol-phosphate aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hisC PE=3 SV=1 429 830 1.0E-42
sp|Q1LT68|HIS8_BAUCH Histidinol-phosphate aminotransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hisC PE=3 SV=1 428 825 1.0E-42
sp|B5YU77|HIS8_ECO5E Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hisC PE=3 SV=1 429 830 1.0E-42
sp|Q9S5G6|HIS8_ECO57 Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 GN=hisC PE=3 SV=1 429 830 1.0E-42
sp|B7MWU0|HIS8_ECO81 Histidinol-phosphate aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=hisC PE=3 SV=1 429 830 1.0E-42
sp|B7LUF2|HIS8_ESCF3 Histidinol-phosphate aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hisC PE=3 SV=1 429 830 1.0E-42
sp|C3LU31|HIS8_VIBCM Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hisC PE=3 SV=1 430 827 2.0E-42
sp|A5F2A2|HIS8_VIBC3 Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hisC PE=3 SV=1 430 827 2.0E-42
sp|B7NQG9|HIS8_ECO7I Histidinol-phosphate aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hisC PE=3 SV=1 429 830 2.0E-42
sp|B5BFB9|HIS8_SALPK Histidinol-phosphate aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=hisC PE=3 SV=1 428 830 2.0E-42
sp|Q5PDP4|HIS8_SALPA Histidinol-phosphate aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisC PE=3 SV=1 428 830 2.0E-42
sp|A9MSC2|HIS8_SALPB Histidinol-phosphate aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hisC PE=3 SV=1 428 830 3.0E-42
sp|B4SX42|HIS8_SALNS Histidinol-phosphate aminotransferase OS=Salmonella newport (strain SL254) GN=hisC PE=3 SV=1 428 830 3.0E-42
sp|B7UT58|HIS8_ECO27 Histidinol-phosphate aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=hisC PE=3 SV=1 429 830 3.0E-42
sp|Q9KSX2|HIS8_VIBCH Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisC PE=3 SV=1 430 827 3.0E-42
sp|B6I848|HIS8_ECOSE Histidinol-phosphate aminotransferase OS=Escherichia coli (strain SE11) GN=hisC PE=3 SV=1 429 830 3.0E-42
sp|P06986|HIS8_ECOLI Histidinol-phosphate aminotransferase OS=Escherichia coli (strain K12) GN=hisC PE=1 SV=2 429 830 3.0E-42
sp|B1X6V8|HIS8_ECODH Histidinol-phosphate aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=hisC PE=3 SV=1 429 830 3.0E-42
sp|C4ZSB0|HIS8_ECOBW Histidinol-phosphate aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hisC PE=3 SV=1 429 830 3.0E-42
sp|B7M400|HIS8_ECO8A Histidinol-phosphate aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=hisC PE=3 SV=1 429 830 3.0E-42
sp|P10369|HIS8_SALTY Histidinol-phosphate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisC PE=3 SV=2 428 830 3.0E-42
sp|B4T9N5|HIS8_SALHS Histidinol-phosphate aminotransferase OS=Salmonella heidelberg (strain SL476) GN=hisC PE=3 SV=1 428 830 3.0E-42
sp|B2TYF9|HIS8_SHIB3 Histidinol-phosphate aminotransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hisC PE=3 SV=1 429 830 4.0E-42
sp|Q3Z0G4|HIS8_SHISS Histidinol-phosphate aminotransferase OS=Shigella sonnei (strain Ss046) GN=hisC PE=3 SV=1 429 830 4.0E-42
sp|Q323J1|HIS8_SHIBS Histidinol-phosphate aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=hisC PE=3 SV=1 429 830 4.0E-42
sp|Q2NTX2|HIS8_SODGM Histidinol-phosphate aminotransferase OS=Sodalis glossinidius (strain morsitans) GN=hisC PE=3 SV=1 428 827 4.0E-42
sp|A7ZNJ3|HIS8_ECO24 Histidinol-phosphate aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisC PE=3 SV=1 429 830 4.0E-42
sp|B1IZ53|HIS8_ECOLC Histidinol-phosphate aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hisC PE=3 SV=1 429 830 5.0E-42
sp|C6DF75|HIS8_PECCP Histidinol-phosphate aminotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hisC PE=3 SV=1 429 827 6.0E-42
sp|B7NC61|HIS8_ECOLU Histidinol-phosphate aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hisC PE=3 SV=1 429 830 1.0E-41
sp|Q1RA52|HIS8_ECOUT Histidinol-phosphate aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=hisC PE=3 SV=1 429 830 1.0E-41
sp|Q8FG51|HIS8_ECOL6 Histidinol-phosphate aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisC PE=3 SV=1 429 830 1.0E-41
sp|Q0TG66|HIS8_ECOL5 Histidinol-phosphate aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hisC PE=3 SV=1 429 830 1.0E-41
sp|Q83KJ6|HIS8_SHIFL Histidinol-phosphate aminotransferase OS=Shigella flexneri GN=hisC PE=3 SV=1 429 830 1.0E-41
sp|Q0T3A6|HIS8_SHIF8 Histidinol-phosphate aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=hisC PE=3 SV=1 429 830 1.0E-41
sp|A4WC70|HIS8_ENT38 Histidinol-phosphate aminotransferase OS=Enterobacter sp. (strain 638) GN=hisC PE=3 SV=1 428 830 2.0E-41
sp|A9ML15|HIS8_SALAR Histidinol-phosphate aminotransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hisC PE=3 SV=1 428 830 2.0E-41
sp|Q8Z5J9|HIS8_SALTI Histidinol-phosphate aminotransferase OS=Salmonella typhi GN=hisC PE=3 SV=1 428 830 2.0E-41
sp|Q65RB2|HIS82_MANSM Histidinol-phosphate aminotransferase 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisC2 PE=3 SV=1 428 827 7.0E-41
sp|A8AEK3|HIS8_CITK8 Histidinol-phosphate aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hisC PE=3 SV=1 429 830 1.0E-40
sp|A1ACN3|HIS8_ECOK1 Histidinol-phosphate aminotransferase OS=Escherichia coli O1:K1 / APEC GN=hisC PE=3 SV=1 429 830 1.0E-40
sp|Q87QL0|HIS8_VIBPA Histidinol-phosphate aminotransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisC PE=3 SV=1 430 837 1.0E-39
sp|A7MX17|HIS8_VIBCB Histidinol-phosphate aminotransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hisC PE=3 SV=1 430 837 4.0E-39
sp|B6EJ89|HIS8_ALISL Histidinol-phosphate aminotransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=hisC PE=3 SV=1 430 827 5.0E-39
sp|Q058A6|HIS8_BUCCC Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=hisC PE=3 SV=1 441 831 5.0E-39
sp|B5FDA0|HIS8_VIBFM Histidinol-phosphate aminotransferase OS=Vibrio fischeri (strain MJ11) GN=hisC PE=3 SV=1 430 827 8.0E-39
sp|B8D707|HIS8_BUCAT Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hisC PE=3 SV=1 429 834 1.0E-38
sp|B8D8Q3|HIS8_BUCA5 Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hisC PE=3 SV=1 429 834 1.0E-38
sp|P57202|HIS8_BUCAI Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisC PE=3 SV=1 429 834 2.0E-38
sp|B0TY45|HIS8_FRAP2 Histidinol-phosphate aminotransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=hisC PE=3 SV=1 431 837 3.0E-38
sp|Q5E637|HIS8_VIBF1 Histidinol-phosphate aminotransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hisC PE=3 SV=1 430 827 3.0E-38
sp|Q24QJ1|HIS8_DESHY Histidinol-phosphate aminotransferase OS=Desulfitobacterium hafniense (strain Y51) GN=hisC PE=3 SV=1 427 835 1.0E-37
sp|Q7MLS5|HIS8_VIBVY Histidinol-phosphate aminotransferase OS=Vibrio vulnificus (strain YJ016) GN=hisC PE=3 SV=1 430 837 2.0E-37
sp|Q47XB7|HIS8_COLP3 Histidinol-phosphate aminotransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hisC PE=3 SV=1 430 826 1.0E-36
sp|Q6LT75|HIS8_PHOPR Histidinol-phosphate aminotransferase OS=Photobacterium profundum GN=hisC PE=3 SV=1 428 827 2.0E-36
sp|Q8D8Q1|HIS8_VIBVU Histidinol-phosphate aminotransferase OS=Vibrio vulnificus (strain CMCP6) GN=hisC PE=3 SV=1 430 837 3.0E-36
sp|B8FP20|HIS8_DESHD Histidinol-phosphate aminotransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hisC PE=3 SV=1 427 835 7.0E-36
sp|Q8EFB2|HIS8_SHEON Histidinol-phosphate aminotransferase OS=Shewanella oneidensis (strain MR-1) GN=hisC PE=3 SV=1 435 790 7.0E-36
sp|A1S6Z2|HIS8_SHEAM Histidinol-phosphate aminotransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=hisC PE=3 SV=1 435 833 1.0E-35
sp|Q5WX92|HIS81_LEGPL Histidinol-phosphate aminotransferase 1 OS=Legionella pneumophila (strain Lens) GN=hisC1 PE=3 SV=1 490 831 1.0E-35
sp|B0K735|HIS8_THEP3 Histidinol-phosphate aminotransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisC PE=3 SV=1 430 821 1.0E-35
sp|B8I5V1|HIS8_CLOCE Histidinol-phosphate aminotransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisC PE=3 SV=1 430 822 6.0E-35
sp|Q5ZW88|HIS81_LEGPH Histidinol-phosphate aminotransferase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hisC1 PE=3 SV=1 492 831 1.0E-34
sp|B0K625|HIS8_THEPX Histidinol-phosphate aminotransferase OS=Thermoanaerobacter sp. (strain X514) GN=hisC PE=3 SV=1 430 821 2.0E-34
sp|Q5X5X0|HIS81_LEGPA Histidinol-phosphate aminotransferase 1 OS=Legionella pneumophila (strain Paris) GN=hisC1 PE=3 SV=1 492 831 2.0E-34
sp|Q3M504|HIS81_ANAVT Histidinol-phosphate aminotransferase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisC1 PE=3 SV=1 465 822 3.0E-34
sp|P0DI07|HIS6B_ARATH Histidinol-phosphate aminotransferase 2, chloroplastic OS=Arabidopsis thaliana GN=HISN6B PE=1 SV=1 496 720 4.0E-33
sp|B9DHD3|HIS6A_ARATH Histidinol-phosphate aminotransferase 1, chloroplastic OS=Arabidopsis thaliana GN=HISN6A PE=1 SV=1 496 720 4.0E-33
sp|A5CZ78|HIS8_PELTS Histidinol-phosphate aminotransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisC PE=3 SV=1 451 834 3.0E-31
sp|Q8R5Q4|HIS8_CALS4 Histidinol-phosphate aminotransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisC PE=3 SV=1 430 821 5.0E-31
sp|A7NFV2|HIS8_ROSCS Histidinol-phosphate aminotransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=hisC PE=3 SV=1 429 833 3.0E-30
sp|A5N7Q7|HIS8_CLOK5 Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hisC PE=3 SV=1 430 835 3.0E-30
sp|B9E168|HIS8_CLOK1 Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=hisC PE=3 SV=1 430 835 3.0E-30
sp|Q3Z879|HIS8_DEHM1 Histidinol-phosphate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisC PE=3 SV=1 455 833 5.0E-30
sp|C5A7A4|HIS8_THEGJ Histidinol-phosphate aminotransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=hisC PE=3 SV=1 438 769 6.0E-30
sp|Q03VY3|HIS8_LEUMM Histidinol-phosphate aminotransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=hisC PE=3 SV=1 493 826 9.0E-30
sp|Q8YV89|HIS81_NOSS1 Histidinol-phosphate aminotransferase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisC1 PE=3 SV=1 430 822 1.0E-29
sp|C1FN41|HIS8_CLOBJ Histidinol-phosphate aminotransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisC PE=3 SV=1 441 833 1.0E-29
sp|Q2JTG5|HIS8_SYNJA Histidinol-phosphate aminotransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=hisC PE=3 SV=1 434 835 2.0E-29
sp|O27624|HIS8_METTH Histidinol-phosphate aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisC PE=3 SV=1 434 835 2.0E-29
sp|Q2JPM4|HIS8_SYNJB Histidinol-phosphate aminotransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hisC PE=3 SV=1 434 835 3.0E-29
sp|O82030|HIS8_TOBAC Histidinol-phosphate aminotransferase, chloroplastic OS=Nicotiana tabacum GN=HPA PE=2 SV=1 434 828 3.0E-29
sp|A5I245|HIS8_CLOBH Histidinol-phosphate aminotransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisC PE=3 SV=1 441 833 4.0E-29
sp|A7FU81|HIS8_CLOB1 Histidinol-phosphate aminotransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisC PE=3 SV=1 441 833 4.0E-29
sp|Q3J7H2|HIS82_NITOC Histidinol-phosphate aminotransferase 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisC2 PE=3 SV=1 434 822 4.0E-29
sp|C0R1Z0|HIS8_BRAHW Histidinol-phosphate aminotransferase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=hisC PE=3 SV=1 492 835 5.0E-29
sp|Q2YAU6|HIS81_NITMU Histidinol-phosphate aminotransferase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisC1 PE=3 SV=1 428 828 6.0E-29
sp|Q3AD52|HIS81_CARHZ Histidinol-phosphate aminotransferase 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisC1 PE=3 SV=1 440 834 7.0E-29
sp|Q9FEW2|HIS8_NICPL Histidinol-phosphate aminotransferase, chloroplastic OS=Nicotiana plumbaginifolia GN=HPA PE=1 SV=1 434 828 7.0E-29
sp|Q311Z4|HIS8_DESAG Histidinol-phosphate aminotransferase OS=Desulfovibrio alaskensis (strain G20) GN=hisC PE=3 SV=1 434 835 8.0E-29
sp|A5V022|HIS8_ROSS1 Histidinol-phosphate aminotransferase OS=Roseiflexus sp. (strain RS-1) GN=hisC PE=3 SV=1 429 822 9.0E-29
sp|B1ILA9|HIS8_CLOBK Histidinol-phosphate aminotransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=hisC PE=3 SV=1 440 833 9.0E-29
sp|Q2SBJ7|HIS8_HAHCH Histidinol-phosphate aminotransferase OS=Hahella chejuensis (strain KCTC 2396) GN=hisC PE=3 SV=1 434 830 1.0E-28
sp|B1N009|HIS8_LEUCK Histidinol-phosphate aminotransferase OS=Leuconostoc citreum (strain KM20) GN=hisC PE=3 SV=1 487 720 1.0E-28
sp|A5FR29|HIS8_DEHMB Histidinol-phosphate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=hisC PE=3 SV=1 428 833 1.0E-28
sp|P60998|HIS8_BDEBA Histidinol-phosphate aminotransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=hisC PE=3 SV=1 434 835 3.0E-28
sp|A4IQ80|HIS8_GEOTN Histidinol-phosphate aminotransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisC PE=3 SV=1 452 835 3.0E-28
sp|Q6FEC7|HIS8_ACIAD Histidinol-phosphate aminotransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisC PE=3 SV=1 436 834 3.0E-28
sp|A1VK38|HIS8_POLNA Histidinol-phosphate aminotransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=hisC PE=3 SV=1 430 827 5.0E-28
sp|Q5KXV3|HIS8_GEOKA Histidinol-phosphate aminotransferase OS=Geobacillus kaustophilus (strain HTA426) GN=hisC PE=3 SV=1 453 835 6.0E-28
sp|Q3ZXL8|HIS8_DEHMC Histidinol-phosphate aminotransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisC PE=3 SV=1 455 833 7.0E-28
sp|Q46Y48|HIS81_CUPPJ Histidinol-phosphate aminotransferase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisC1 PE=3 SV=1 492 835 1.0E-27
sp|A7HCR6|HIS8_ANADF Histidinol-phosphate aminotransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=hisC PE=3 SV=1 433 834 1.0E-27
sp|A7GDQ6|HIS8_CLOBL Histidinol-phosphate aminotransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hisC PE=3 SV=1 441 824 1.0E-27
sp|Q46WL3|HIS82_CUPPJ Histidinol-phosphate aminotransferase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisC2 PE=1 SV=1 430 828 1.0E-27
sp|Q8EQB9|HIS82_OCEIH Histidinol-phosphate aminotransferase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisC2 PE=3 SV=1 455 826 2.0E-27
sp|Q8TH25|HIS8_PYRFU Histidinol-phosphate aminotransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisC PE=3 SV=1 433 830 2.0E-27
sp|B7GHJ8|HIS8_ANOFW Histidinol-phosphate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hisC PE=3 SV=1 485 835 2.0E-27
sp|Q73AX7|HIS81_BACC1 Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisC1 PE=3 SV=1 452 833 2.0E-27
sp|O28255|HIS82_ARCFU Histidinol-phosphate aminotransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisC2 PE=3 SV=1 495 833 3.0E-27
sp|Q9KCA8|HIS8_BACHD Histidinol-phosphate aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisC PE=3 SV=1 434 822 3.0E-27
sp|Q3ARM7|HIS8_CHLCH Histidinol-phosphate aminotransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisC PE=3 SV=1 494 833 5.0E-27
sp|Q71Y90|HIS8_LISMF Histidinol-phosphate aminotransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisC PE=3 SV=1 457 834 8.0E-27
sp|C3KVX5|HIS8_CLOB6 Histidinol-phosphate aminotransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisC PE=3 SV=1 440 833 9.0E-27
sp|C1KWM5|HIS8_LISMC Histidinol-phosphate aminotransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisC PE=3 SV=1 457 834 1.0E-26
sp|A6UPL6|HIS8_METVS Histidinol-phosphate aminotransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisC PE=3 SV=1 430 835 1.0E-26
sp|Q4FQF9|HIS82_PSYA2 Histidinol-phosphate aminotransferase 2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hisC2 PE=3 SV=1 457 830 2.0E-26
sp|Q2RL44|HIS8_MOOTA Histidinol-phosphate aminotransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisC PE=3 SV=1 435 834 2.0E-26
sp|Q6HL37|HIS81_BACHK Histidinol-phosphate aminotransferase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisC1 PE=3 SV=1 452 833 2.0E-26
sp|Q63Q87|HIS82_BURPS Histidinol-phosphate aminotransferase 2 OS=Burkholderia pseudomallei (strain K96243) GN=hisC2 PE=3 SV=1 431 822 3.0E-26
sp|Q62GE0|HIS81_BURMA Histidinol-phosphate aminotransferase 1 OS=Burkholderia mallei (strain ATCC 23344) GN=hisC1 PE=3 SV=1 431 822 3.0E-26
sp|Q3IRT1|HIS8_NATPD Histidinol-phosphate aminotransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisC PE=3 SV=1 455 828 3.0E-26
sp|B8DC01|HIS8_LISMH Histidinol-phosphate aminotransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hisC PE=3 SV=1 457 834 3.0E-26
sp|Q81SV5|HIS81_BACAN Histidinol-phosphate aminotransferase 1 OS=Bacillus anthracis GN=hisC1 PE=3 SV=1 434 833 3.0E-26
sp|Q3JMZ7|HIS82_BURP1 Histidinol-phosphate aminotransferase 2 OS=Burkholderia pseudomallei (strain 1710b) GN=hisC2 PE=3 SV=1 431 822 3.0E-26
sp|Q8KD01|HIS8_CHLTE Histidinol-phosphate aminotransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisC PE=3 SV=1 494 833 4.0E-26
sp|P61003|HIS8_METMP Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisC PE=3 SV=1 455 833 6.0E-26
sp|B7I6C5|HIS8_ACIB5 Histidinol-phosphate aminotransferase OS=Acinetobacter baumannii (strain AB0057) GN=hisC PE=3 SV=1 436 832 7.0E-26
sp|B7GZI3|HIS8_ACIB3 Histidinol-phosphate aminotransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=hisC PE=3 SV=1 436 832 7.0E-26
sp|A4SE60|HIS8_CHLPM Histidinol-phosphate aminotransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisC PE=3 SV=1 494 822 8.0E-26
sp|P17731|HIS8_BACSU Histidinol-phosphate aminotransferase OS=Bacillus subtilis (strain 168) GN=hisC PE=3 SV=3 434 834 1.0E-25
sp|A3M2I8|HIS8_ACIBT Histidinol-phosphate aminotransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hisC PE=3 SV=2 436 832 1.0E-25
sp|Q5QZ49|HIS81_IDILO Histidinol-phosphate aminotransferase 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisC1 PE=3 SV=1 428 833 1.0E-25
sp|Q8KZ92|HIS8_BACNA Histidinol-phosphate aminotransferase OS=Bacillus subtilis subsp. natto GN=hisC PE=3 SV=1 434 834 1.0E-25
sp|Q7NL03|HIS8_GLOVI Histidinol-phosphate aminotransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=hisC PE=3 SV=1 434 834 1.0E-25
sp|A0AK37|HIS8_LISW6 Histidinol-phosphate aminotransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisC PE=3 SV=1 457 834 1.0E-25
sp|A4FWW1|HIS8_METM5 Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisC PE=3 SV=1 492 833 2.0E-25
sp|Q63DL4|HIS81_BACCZ Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ZK / E33L) GN=hisC1 PE=3 SV=1 452 833 2.0E-25
sp|B0VV21|HIS8_ACIBS Histidinol-phosphate aminotransferase OS=Acinetobacter baumannii (strain SDF) GN=hisC PE=3 SV=1 436 832 2.0E-25
sp|A1R558|HIS8_ARTAT Histidinol-phosphate aminotransferase OS=Arthrobacter aurescens (strain TC1) GN=hisC PE=3 SV=1 434 830 2.0E-25
sp|Q5JFU6|HIS8_THEKO Histidinol-phosphate aminotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hisC PE=3 SV=1 433 707 2.0E-25
sp|Q10VS0|HIS8_TRIEI Histidinol-phosphate aminotransferase OS=Trichodesmium erythraeum (strain IMS101) GN=hisC PE=3 SV=1 434 834 3.0E-25
sp|Q72DA0|HIS8_DESVH Histidinol-phosphate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisC PE=3 SV=1 426 836 3.0E-25
sp|Q7VIJ3|HIS8_HELHP Histidinol-phosphate aminotransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisC PE=3 SV=1 480 828 3.0E-25
sp|Q845V2|HIS8_BURM1 Histidinol-phosphate aminotransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisC PE=3 SV=1 431 822 3.0E-25
sp|Q8ESS3|HIS81_OCEIH Histidinol-phosphate aminotransferase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisC1 PE=3 SV=1 455 835 4.0E-25
sp|C5D3D2|HIS8_GEOSW Histidinol-phosphate aminotransferase OS=Geobacillus sp. (strain WCH70) GN=hisC PE=3 SV=1 455 835 4.0E-25
sp|B2GBR8|HIS8_LACF3 Histidinol-phosphate aminotransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisC PE=3 SV=1 442 709 4.0E-25
sp|Q5LNM6|HIS8_RUEPO Histidinol-phosphate aminotransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisC PE=3 SV=2 435 835 5.0E-25
sp|Q39K90|HIS81_BURL3 Histidinol-phosphate aminotransferase 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisC1 PE=3 SV=1 431 822 5.0E-25
sp|Q88UE6|HIS8_LACPL Histidinol-phosphate aminotransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisC PE=3 SV=1 452 754 5.0E-25
sp|Q58365|HIS8_METJA Histidinol-phosphate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisC PE=3 SV=1 430 833 5.0E-25
sp|Q8CTG8|HIS8_STAES Histidinol-phosphate aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisC PE=3 SV=1 457 836 5.0E-25
sp|Q2W047|HIS8_MAGSA Histidinol-phosphate aminotransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisC PE=3 SV=1 435 830 5.0E-25
sp|Q5HR08|HIS8_STAEQ Histidinol-phosphate aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisC PE=3 SV=1 457 836 6.0E-25
sp|Q8Y0Y8|HIS82_RALSO Histidinol-phosphate aminotransferase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=hisC2 PE=3 SV=1 455 822 7.0E-25
sp|A6VGF6|HIS8_METM7 Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisC PE=3 SV=1 455 833 8.0E-25
sp|Q67KI2|HIS8_SYMTH Histidinol-phosphate aminotransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisC PE=3 SV=1 455 830 8.0E-25
sp|Q4FSH2|HIS81_PSYA2 Histidinol-phosphate aminotransferase 1 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hisC1 PE=3 SV=1 437 834 8.0E-25
sp|A8YZZ5|HIS8_STAAT Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|P67725|HIS8_STAAN Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain N315) GN=hisC PE=1 SV=1 445 836 8.0E-25
sp|P67724|HIS8_STAAM Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|A6QF32|HIS8_STAAE Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Newman) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|Q5HHU9|HIS8_STAAC Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain COL) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|A5IQS7|HIS8_STAA9 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain JH9) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|Q2G087|HIS8_STAA8 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|Q2FIR7|HIS8_STAA3 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain USA300) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|A6TZK2|HIS8_STAA2 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain JH1) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|A7WZL0|HIS8_STAA1 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisC PE=3 SV=1 445 836 8.0E-25
sp|A5G9G1|HIS8_GEOUR Histidinol-phosphate aminotransferase OS=Geobacter uraniireducens (strain Rf4) GN=hisC PE=3 SV=1 434 833 9.0E-25
sp|Q92A83|HIS8_LISIN Histidinol-phosphate aminotransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisC PE=1 SV=1 457 834 9.0E-25
sp|Q8TVG3|HIS8_METKA Histidinol-phosphate aminotransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisC PE=3 SV=1 434 835 1.0E-24
sp|Q8NXN3|HIS8_STAAW Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MW2) GN=hisC PE=3 SV=1 445 836 1.0E-24
sp|Q6GBA6|HIS8_STAAS Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MSSA476) GN=hisC PE=3 SV=1 445 836 1.0E-24
sp|Q2YSI3|HIS8_STAAB Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisC PE=3 SV=1 445 836 1.0E-24
sp|Q8Y5X8|HIS8_LISMO Histidinol-phosphate aminotransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisC PE=3 SV=1 457 834 1.0E-24
sp|P17736|HIS8_HALVD Histidinol-phosphate aminotransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=hisC PE=3 SV=1 434 833 1.0E-24
sp|A0PXP5|HIS8_CLONN Histidinol-phosphate aminotransferase OS=Clostridium novyi (strain NT) GN=hisC PE=3 SV=1 430 827 2.0E-24
sp|B5E9W9|HIS8_GEOBB Histidinol-phosphate aminotransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisC PE=3 SV=1 493 830 2.0E-24
sp|A3PIA4|HIS8_RHOS1 Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hisC PE=3 SV=1 435 835 2.0E-24
sp|A7Z614|HIS8_BACMF Histidinol-phosphate aminotransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisC PE=3 SV=1 492 834 2.0E-24
sp|Q7UNC3|HIS8_RHOBA Histidinol-phosphate aminotransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisC PE=3 SV=1 435 824 2.0E-24
sp|Q3SI68|HIS82_THIDA Histidinol-phosphate aminotransferase 2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisC2 PE=3 SV=1 455 830 2.0E-24
sp|A1VEW4|HIS8_DESVV Histidinol-phosphate aminotransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hisC PE=3 SV=1 426 768 2.0E-24
sp|Q49VS0|HIS8_STAS1 Histidinol-phosphate aminotransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisC PE=3 SV=1 457 719 2.0E-24
sp|Q2LST8|HIS8_SYNAS Histidinol-phosphate aminotransferase OS=Syntrophus aciditrophicus (strain SB) GN=hisC PE=3 SV=1 493 834 2.0E-24
sp|C6E916|HIS8_GEOSM Histidinol-phosphate aminotransferase OS=Geobacter sp. (strain M21) GN=hisC PE=3 SV=1 450 830 2.0E-24
sp|Q2NEQ0|HIS8_METST Histidinol-phosphate aminotransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisC PE=3 SV=1 455 720 3.0E-24
sp|Q1GET3|HIS8_RUEST Histidinol-phosphate aminotransferase OS=Ruegeria sp. (strain TM1040) GN=hisC PE=3 SV=1 435 835 3.0E-24
sp|Q3J445|HIS8_RHOS4 Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisC PE=3 SV=1 435 835 3.0E-24
sp|A6UTL8|HIS8_META3 Histidinol-phosphate aminotransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisC PE=3 SV=1 453 719 3.0E-24
sp|B9KPH4|HIS8_RHOSK Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisC PE=3 SV=1 435 835 4.0E-24
sp|Q4KI72|HIS81_PSEF5 Histidinol-phosphate aminotransferase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisC1 PE=3 SV=1 455 833 4.0E-24
sp|Q12U08|HIS8_METBU Histidinol-phosphate aminotransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisC PE=3 SV=1 452 833 4.0E-24
sp|A9AA96|HIS8_METM6 Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisC PE=3 SV=1 455 833 4.0E-24
sp|Q18F03|HIS8_HALWD Histidinol-phosphate aminotransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisC PE=3 SV=1 434 835 4.0E-24
sp|B3DXN2|HIS8_METI4 Histidinol-phosphate aminotransferase OS=Methylacidiphilum infernorum (isolate V4) GN=hisC PE=3 SV=1 434 823 5.0E-24
sp|A7GN55|HIS8_BACCN Histidinol-phosphate aminotransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisC PE=3 SV=1 452 835 5.0E-24
sp|Q02YW3|HIS8_LACLS Histidinol-phosphate aminotransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hisC PE=3 SV=1 437 835 5.0E-24
sp|B0V7Q2|HIS8_ACIBY Histidinol-phosphate aminotransferase OS=Acinetobacter baumannii (strain AYE) GN=hisC PE=3 SV=1 436 832 5.0E-24
sp|B2HTW5|HIS8_ACIBC Histidinol-phosphate aminotransferase OS=Acinetobacter baumannii (strain ACICU) GN=hisC PE=3 SV=1 436 832 5.0E-24
sp|Q736A5|HIS82_BACC1 Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisC2 PE=3 SV=1 466 835 5.0E-24
sp|A1TKZ0|HIS8_ACIAC Histidinol-phosphate aminotransferase OS=Acidovorax citrulli (strain AAC00-1) GN=hisC PE=3 SV=1 434 830 5.0E-24
sp|B9LZ53|HIS8_GEODF Histidinol-phosphate aminotransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisC PE=3 SV=1 434 827 7.0E-24
sp|Q9CMI7|HIS82_PASMU Histidinol-phosphate aminotransferase 2 OS=Pasteurella multocida (strain Pm70) GN=hisC2 PE=3 SV=1 432 834 8.0E-24
sp|Q6GIR8|HIS8_STAAR Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MRSA252) GN=hisC PE=3 SV=1 445 836 1.0E-23
sp|A4XMY1|HIS8_CALS8 Histidinol-phosphate aminotransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hisC PE=3 SV=1 455 834 1.0E-23
sp|B1JBC0|HIS8_PSEPW Histidinol-phosphate aminotransferase OS=Pseudomonas putida (strain W619) GN=hisC PE=3 SV=1 455 830 2.0E-23
sp|B4S8L6|HIS8_PROA2 Histidinol-phosphate aminotransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisC PE=3 SV=1 494 833 2.0E-23
sp|Q609W4|HIS81_METCA Histidinol-phosphate aminotransferase 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisC1 PE=3 SV=1 455 833 2.0E-23
sp|B9MDV4|HIS8_ACIET Histidinol-phosphate aminotransferase OS=Acidovorax ebreus (strain TPSY) GN=hisC PE=3 SV=1 434 822 2.0E-23
sp|Q9A671|HIS81_CAUCR Histidinol-phosphate aminotransferase 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisC1 PE=3 SV=1 435 832 2.0E-23
sp|Q7M7Y6|HIS8_WOLSU Histidinol-phosphate aminotransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisC PE=3 SV=1 455 723 2.0E-23
sp|B1HTD4|HIS8_LYSSC Histidinol-phosphate aminotransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=hisC PE=3 SV=1 453 835 2.0E-23
sp|C0ZCE7|HIS8_BREBN Histidinol-phosphate aminotransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hisC PE=3 SV=1 452 833 2.0E-23
sp|A5CVR5|HIS8_VESOH Histidinol-phosphate aminotransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisC PE=3 SV=1 489 834 2.0E-23
sp|Q6HHF6|HIS82_BACHK Histidinol-phosphate aminotransferase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisC2 PE=3 SV=1 466 835 2.0E-23
sp|Q5V4K3|HIS8_HALMA Histidinol-phosphate aminotransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisC PE=3 SV=1 493 835 2.0E-23
sp|Q0BVW4|HIS8_GRABC Histidinol-phosphate aminotransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisC PE=3 SV=1 436 830 3.0E-23
sp|Q9C9G4|ENDO2_ARATH Endonuclease 2 OS=Arabidopsis thaliana GN=ENDO2 PE=1 SV=1 15 231 3.0E-23
sp|Q7P0F4|HIS8_CHRVO Histidinol-phosphate aminotransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisC PE=3 SV=1 428 834 4.0E-23
sp|Q0AM22|HIS8_MARMM Histidinol-phosphate aminotransferase OS=Maricaulis maris (strain MCS10) GN=hisC PE=3 SV=1 435 835 4.0E-23
sp|Q2RP86|HIS8_RHORT Histidinol-phosphate aminotransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisC PE=3 SV=1 435 831 4.0E-23
sp|A4WUN9|HIS8_RHOS5 Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisC PE=3 SV=1 435 835 5.0E-23
sp|Q97ES6|HIS8_CLOAB Histidinol-phosphate aminotransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisC PE=3 SV=1 490 830 6.0E-23
sp|A6LUF3|HIS8_CLOB8 Histidinol-phosphate aminotransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisC PE=3 SV=1 455 830 7.0E-23
sp|Q57004|HIS82_HAEIN Histidinol-phosphate aminotransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisC2 PE=3 SV=1 432 836 7.0E-23
sp|Q8TUE9|HIS8_METAC Histidinol-phosphate aminotransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisC PE=3 SV=1 455 827 8.0E-23
sp|A2SE05|HIS8_METPP Histidinol-phosphate aminotransferase OS=Methylibium petroleiphilum (strain PM1) GN=hisC PE=3 SV=1 430 834 9.0E-23
sp|Q30TC9|HIS8_SULDN Histidinol-phosphate aminotransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisC PE=3 SV=1 457 822 9.0E-23
sp|Q63A05|HIS82_BACCZ Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ZK / E33L) GN=hisC2 PE=3 SV=1 466 835 1.0E-22
sp|Q163G3|HIS8_ROSDO Histidinol-phosphate aminotransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisC PE=3 SV=1 435 709 1.0E-22
sp|Q31GD4|HIS82_THICR Histidinol-phosphate aminotransferase 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=hisC2 PE=3 SV=1 457 834 1.0E-22
sp|Q1IE97|HIS8_PSEE4 Histidinol-phosphate aminotransferase OS=Pseudomonas entomophila (strain L48) GN=hisC PE=3 SV=1 455 821 2.0E-22
sp|A0RMN9|HIS8_CAMFF Histidinol-phosphate aminotransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hisC PE=3 SV=1 450 719 2.0E-22
sp|Q4QLD1|HIS82_HAEI8 Histidinol-phosphate aminotransferase 2 OS=Haemophilus influenzae (strain 86-028NP) GN=hisC2 PE=3 SV=1 432 836 2.0E-22
sp|Q20YH9|HIS8_RHOPB Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisC PE=3 SV=1 433 831 2.0E-22
sp|B4SGL8|HIS8_PELPB Histidinol-phosphate aminotransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisC PE=3 SV=1 494 832 3.0E-22
sp|Q28TL1|HIS8_JANSC Histidinol-phosphate aminotransferase OS=Jannaschia sp. (strain CCS1) GN=hisC PE=3 SV=1 435 830 3.0E-22
sp|Q8PX17|HIS8_METMA Histidinol-phosphate aminotransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisC PE=3 SV=1 455 827 3.0E-22
sp|B9EAC1|HIS8_MACCJ Histidinol-phosphate aminotransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=hisC PE=3 SV=1 457 719 5.0E-22
sp|A4QFG6|HIS8_CORGB Histidinol-phosphate aminotransferase OS=Corynebacterium glutamicum (strain R) GN=hisC PE=3 SV=1 455 835 6.0E-22
sp|A8LK96|HIS8_DINSH Histidinol-phosphate aminotransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisC PE=3 SV=1 455 828 7.0E-22
sp|Q5P791|HIS8_AROAE Histidinol-phosphate aminotransferase OS=Aromatoleum aromaticum (strain EbN1) GN=hisC PE=3 SV=1 455 835 7.0E-22
sp|A8FEJ6|HIS8_BACP2 Histidinol-phosphate aminotransferase OS=Bacillus pumilus (strain SAFR-032) GN=hisC PE=3 SV=1 455 835 7.0E-22
sp|P45358|HIS8_ACEPA Histidinol-phosphate aminotransferase OS=Acetobacter pasteurianus GN=hisC PE=3 SV=1 455 834 7.0E-22
sp|Q81P62|HIS82_BACAN Histidinol-phosphate aminotransferase 2 OS=Bacillus anthracis GN=hisC2 PE=3 SV=1 466 835 8.0E-22
sp|B3PCJ2|HIS8_CELJU Histidinol-phosphate aminotransferase OS=Cellvibrio japonicus (strain Ueda107) GN=hisC PE=3 SV=1 436 832 8.0E-22
sp|Q82WM3|HIS81_NITEU Histidinol-phosphate aminotransferase 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisC1 PE=3 SV=1 431 822 8.0E-22
sp|Q81FQ1|HIS81_BACCR Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisC1 PE=3 SV=1 434 833 9.0E-22
sp|Q62FC0|HIS82_BURMA Histidinol-phosphate aminotransferase 2 OS=Burkholderia mallei (strain ATCC 23344) GN=hisC2 PE=3 SV=1 455 834 9.0E-22
sp|Q31I36|HIS81_THICR Histidinol-phosphate aminotransferase 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=hisC1 PE=3 SV=1 480 835 9.0E-22
sp|Q3KHZ1|HIS81_PSEPF Histidinol-phosphate aminotransferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisC1 PE=3 SV=1 455 833 9.0E-22
sp|B3ECG2|HIS8_CHLL2 Histidinol-phosphate aminotransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisC PE=3 SV=1 494 830 1.0E-21
sp|Q4JW58|HIS8_CORJK Histidinol-phosphate aminotransferase OS=Corynebacterium jeikeium (strain K411) GN=hisC PE=3 SV=1 457 834 1.0E-21
sp|Q9KJU4|HIS8_CORGL Histidinol-phosphate aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisC PE=1 SV=2 455 835 1.0E-21
sp|Q07IG8|HIS8_RHOP5 Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=hisC PE=3 SV=1 433 830 1.0E-21
sp|Q608S3|HIS82_METCA Histidinol-phosphate aminotransferase 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisC2 PE=3 SV=1 455 834 1.0E-21
sp|P73807|HIS8_SYNY3 Histidinol-phosphate aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisC PE=3 SV=2 496 827 1.0E-21
sp|Q9HZ68|HIS82_PSEAE Histidinol-phosphate aminotransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisC2 PE=3 SV=1 435 836 1.0E-21
sp|B2HQA3|HIS8_MYCMM Histidinol-phosphate aminotransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisC PE=3 SV=1 455 833 2.0E-21
sp|B9LNJ8|HIS8_HALLT Histidinol-phosphate aminotransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=hisC PE=3 SV=1 434 834 2.0E-21
sp|Q46E46|HIS8_METBF Histidinol-phosphate aminotransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisC PE=3 SV=1 455 827 2.0E-21
sp|Q8YMG7|HIS82_NOSS1 Histidinol-phosphate aminotransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisC2 PE=3 SV=1 491 822 2.0E-21
sp|Q1R089|HIS8_CHRSD Histidinol-phosphate aminotransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisC PE=3 SV=1 436 833 2.0E-21
sp|P61000|HIS8_GEOSL Histidinol-phosphate aminotransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisC PE=3 SV=1 434 833 2.0E-21
sp|Q3B3L3|HIS8_CHLL7 Histidinol-phosphate aminotransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisC PE=3 SV=1 494 835 2.0E-21
sp|B1WY56|HIS8_CYAA5 Histidinol-phosphate aminotransferase OS=Cyanothece sp. (strain ATCC 51142) GN=hisC PE=3 SV=1 452 833 2.0E-21
sp|Q6AQK2|HIS8_DESPS Histidinol-phosphate aminotransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisC PE=3 SV=1 452 835 2.0E-21
sp|Q6ABU3|PATR_PROAC Putative phenylalanine aminotransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pat PE=3 SV=1 448 835 3.0E-21
sp|Q81C43|HIS82_BACCR Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisC2 PE=3 SV=1 466 835 3.0E-21
sp|Q9RI00|HIS8_PSEST Histidinol-phosphate aminotransferase OS=Pseudomonas stutzeri GN=hisC PE=3 SV=1 455 834 3.0E-21
sp|P16246|HIS8_STRCO Histidinol-phosphate aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisC PE=3 SV=1 428 835 3.0E-21
sp|Q89UL9|HIS82_BRADU Histidinol-phosphate aminotransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisC2 PE=3 SV=1 433 828 4.0E-21
sp|Q4L4E7|HIS8_STAHJ Histidinol-phosphate aminotransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hisC PE=3 SV=1 457 836 4.0E-21
sp|Q87WV6|HIS8_PSESM Histidinol-phosphate aminotransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisC PE=3 SV=1 455 833 4.0E-21
sp|Q4ZNW0|HIS8_PSEU2 Histidinol-phosphate aminotransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisC PE=3 SV=1 455 833 4.0E-21
sp|B9DK21|HIS8_STACT Histidinol-phosphate aminotransferase OS=Staphylococcus carnosus (strain TM300) GN=hisC PE=3 SV=1 457 828 5.0E-21
sp|A0PP15|HIS8_MYCUA Histidinol-phosphate aminotransferase OS=Mycobacterium ulcerans (strain Agy99) GN=hisC PE=3 SV=1 455 833 5.0E-21
sp|A7ZCF3|HIS8_CAMC1 Histidinol-phosphate aminotransferase OS=Campylobacter concisus (strain 13826) GN=hisC PE=3 SV=1 450 729 6.0E-21
sp|A2RKS5|HIS8_LACLM Histidinol-phosphate aminotransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hisC PE=3 SV=1 437 835 7.0E-21
sp|Q3A7R3|HIS8_PELCD Histidinol-phosphate aminotransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisC PE=3 SV=1 457 833 7.0E-21
sp|Q63XM1|HIS81_BURPS Histidinol-phosphate aminotransferase 1 OS=Burkholderia pseudomallei (strain K96243) GN=hisC1 PE=3 SV=1 455 834 7.0E-21
sp|Q3JW89|HIS81_BURP1 Histidinol-phosphate aminotransferase 1 OS=Burkholderia pseudomallei (strain 1710b) GN=hisC1 PE=3 SV=1 455 834 7.0E-21
sp|A7H556|HIS8_CAMJD Histidinol-phosphate aminotransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hisC PE=3 SV=1 494 835 7.0E-21
sp|A8FKA6|HIS8_CAMJ8 Histidinol-phosphate aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hisC PE=3 SV=1 494 835 7.0E-21
sp|A6VUD3|HIS8_MARMS Histidinol-phosphate aminotransferase OS=Marinomonas sp. (strain MWYL1) GN=hisC PE=3 SV=1 493 823 7.0E-21
sp|Q88P86|HIS8_PSEPK Histidinol-phosphate aminotransferase OS=Pseudomonas putida (strain KT2440) GN=hisC PE=3 SV=1 455 821 8.0E-21
sp|B8HW95|HIS8_CYAP4 Histidinol-phosphate aminotransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=hisC PE=3 SV=1 490 834 9.0E-21
sp|Q02135|HIS8_LACLA Histidinol-phosphate aminotransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisC PE=3 SV=3 437 835 9.0E-21
sp|A5FVN2|HIS8_ACICJ Histidinol-phosphate aminotransferase OS=Acidiphilium cryptum (strain JF-5) GN=hisC PE=3 SV=1 435 830 1.0E-20
sp|Q3SV41|HIS8_NITWN Histidinol-phosphate aminotransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisC PE=3 SV=1 433 821 1.0E-20
sp|Q89GX0|HIS81_BRADU Histidinol-phosphate aminotransferase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisC1 PE=3 SV=1 436 828 1.0E-20
sp|Q82XE0|HIS82_NITEU Histidinol-phosphate aminotransferase 2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisC2 PE=3 SV=1 453 835 1.0E-20
sp|A5VZ57|HIS8_PSEP1 Histidinol-phosphate aminotransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisC PE=3 SV=1 455 821 1.0E-20
sp|Q9X7B8|HIS8_MYCLE Histidinol-phosphate aminotransferase OS=Mycobacterium leprae (strain TN) GN=hisC PE=3 SV=1 423 822 2.0E-20
sp|B8ZRB0|HIS8_MYCLB Histidinol-phosphate aminotransferase OS=Mycobacterium leprae (strain Br4923) GN=hisC PE=3 SV=1 423 822 2.0E-20
sp|B3QP11|HIS8_CHLP8 Histidinol-phosphate aminotransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisC PE=3 SV=1 494 828 2.0E-20
sp|Q47QS8|HIS8_THEFY Histidinol-phosphate aminotransferase OS=Thermobifida fusca (strain YX) GN=hisC PE=3 SV=1 493 823 2.0E-20
sp|A8EWM9|HIS8_ARCB4 Histidinol-phosphate aminotransferase OS=Arcobacter butzleri (strain RM4018) GN=hisC PE=3 SV=1 450 720 2.0E-20
sp|Q3AAT6|HIS82_CARHZ Histidinol-phosphate aminotransferase 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisC2 PE=3 SV=1 457 819 2.0E-20
sp|Q9HVX0|HIS81_PSEAE Histidinol-phosphate aminotransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisC1 PE=3 SV=1 452 830 2.0E-20
sp|B2IDA4|HIS8_BEII9 Histidinol-phosphate aminotransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisC PE=3 SV=1 434 830 2.0E-20
sp|B0JJJ7|HIS8_MICAN Histidinol-phosphate aminotransferase OS=Microcystis aeruginosa (strain NIES-843) GN=hisC PE=3 SV=1 496 833 2.0E-20
sp|A1VY36|HIS8_CAMJJ Histidinol-phosphate aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hisC PE=3 SV=1 494 835 3.0E-20
sp|Q8XV80|HIS81_RALSO Histidinol-phosphate aminotransferase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=hisC1 PE=3 SV=1 490 828 3.0E-20
sp|B3Q8Z5|HIS8_RHOPT Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisC PE=3 SV=1 433 832 3.0E-20
sp|P61002|HIS8_RHOPA Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisC PE=3 SV=1 433 832 3.0E-20
sp|B2UPR9|HIS8_AKKM8 Histidinol-phosphate aminotransferase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=hisC PE=3 SV=1 455 834 3.0E-20
sp|Q9PII2|HIS8_CAMJE Histidinol-phosphate aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisC PE=1 SV=1 494 835 3.0E-20
sp|B7JUI4|HIS8_CYAP8 Histidinol-phosphate aminotransferase OS=Cyanothece sp. (strain PCC 8801) GN=hisC PE=3 SV=1 452 833 3.0E-20
sp|Q5HWF4|HIS8_CAMJR Histidinol-phosphate aminotransferase OS=Campylobacter jejuni (strain RM1221) GN=hisC PE=3 SV=1 494 835 3.0E-20
sp|O28277|HIS81_ARCFU Histidinol-phosphate aminotransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisC1 PE=3 SV=1 492 834 3.0E-20
sp|Q3K8U2|HIS82_PSEPF Histidinol-phosphate aminotransferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisC2 PE=3 SV=1 429 834 4.0E-20
sp|B0KQJ6|HIS8_PSEPG Histidinol-phosphate aminotransferase OS=Pseudomonas putida (strain GB-1) GN=hisC PE=3 SV=1 455 821 4.0E-20
sp|Q3MAX6|HIS82_ANAVT Histidinol-phosphate aminotransferase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisC2 PE=3 SV=1 491 822 4.0E-20
sp|Q48ED0|HIS8_PSE14 Histidinol-phosphate aminotransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisC PE=3 SV=1 455 833 5.0E-20
sp|A1W431|HIS8_ACISJ Histidinol-phosphate aminotransferase OS=Acidovorax sp. (strain JS42) GN=hisC PE=3 SV=1 434 822 5.0E-20
sp|Q51687|HIS8_PARDP Histidinol-phosphate aminotransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisC PE=3 SV=2 493 832 5.0E-20
sp|A5UKY0|HIS8_METS3 Histidinol-phosphate aminotransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisC PE=3 SV=1 492 834 6.0E-20
sp|Q82AA5|HIS8_STRAW Histidinol-phosphate aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisC PE=3 SV=1 428 835 6.0E-20
sp|Q8U9W3|HIS8_AGRFC Histidinol-phosphate aminotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisC PE=3 SV=1 433 832 6.0E-20
sp|Q4K8N0|HIS82_PSEF5 Histidinol-phosphate aminotransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisC2 PE=3 SV=1 435 834 6.0E-20
sp|Q8FNZ1|HIS8_COREF Histidinol-phosphate aminotransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisC PE=3 SV=1 455 822 7.0E-20
sp|Q65S79|HIS81_MANSM Histidinol-phosphate aminotransferase 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisC1 PE=3 SV=2 438 834 7.0E-20
sp|Q7WHN5|HIS81_BORBR Histidinol-phosphate aminotransferase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisC1 PE=3 SV=1 455 834 8.0E-20
sp|Q7W6Q1|HIS81_BORPA Histidinol-phosphate aminotransferase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisC1 PE=3 SV=1 455 834 8.0E-20
sp|P60999|HIS8_CORDI Histidinol-phosphate aminotransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisC PE=3 SV=1 455 822 8.0E-20
sp|Q47AL9|HIS82_DECAR Histidinol-phosphate aminotransferase 2 OS=Dechloromonas aromatica (strain RCB) GN=hisC2 PE=3 SV=1 455 833 9.0E-20
sp|Q2IS68|HIS8_RHOP2 Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=hisC PE=3 SV=1 433 830 9.0E-20
sp|O67857|HIS8_AQUAE Histidinol-phosphate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=hisC PE=3 SV=1 493 835 1.0E-19
sp|Q9JYH7|HIS8_NEIMB Histidinol-phosphate aminotransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisC PE=3 SV=1 493 834 1.0E-19
sp|A3CWS8|HIS8_METMJ Histidinol-phosphate aminotransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=hisC PE=3 SV=1 457 722 1.0E-19
sp|B4RJ05|HIS8_NEIG2 Histidinol-phosphate aminotransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=hisC PE=3 SV=1 429 835 2.0E-19
sp|Q5F7D7|HIS8_NEIG1 Histidinol-phosphate aminotransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisC PE=3 SV=1 429 835 2.0E-19
sp|Q8G4S8|HIS8_BIFLO Histidinol-phosphate aminotransferase OS=Bifidobacterium longum (strain NCC 2705) GN=hisC PE=3 SV=1 434 835 2.0E-19
sp|Q39CT7|HIS82_BURL3 Histidinol-phosphate aminotransferase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisC2 PE=3 SV=1 455 834 2.0E-19
sp|B6IYQ0|HIS8_RHOCS Histidinol-phosphate aminotransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisC PE=3 SV=1 436 835 2.0E-19
sp|P24021|NUS1_ASPOR Nuclease S1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nucS PE=1 SV=2 21 201 2.0E-19
sp|B9K9R9|HIS8_THENN Histidinol-phosphate aminotransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=hisC PE=3 SV=1 442 835 2.0E-19
sp|Q5YYP9|HIS8_NOCFA Histidinol-phosphate aminotransferase OS=Nocardia farcinica (strain IFM 10152) GN=hisC PE=3 SV=1 434 828 2.0E-19
sp|Q7VWL5|HIS81_BORPE Histidinol-phosphate aminotransferase 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisC1 PE=3 SV=1 455 834 3.0E-19
sp|Q65I37|HIS8_BACLD Histidinol-phosphate aminotransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisC PE=3 SV=1 496 824 3.0E-19
sp|P9WML7|HIS8_MYCTU Histidinol-phosphate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisC PE=1 SV=1 455 833 4.0E-19
sp|P9WML6|HIS8_MYCTO Histidinol-phosphate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisC PE=3 SV=1 455 833 4.0E-19
sp|A5U2V6|HIS8_MYCTA Histidinol-phosphate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisC PE=3 SV=1 455 833 4.0E-19
sp|C1ANM2|HIS8_MYCBT Histidinol-phosphate aminotransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisC PE=3 SV=1 455 833 4.0E-19
sp|A1KJ16|HIS8_MYCBP Histidinol-phosphate aminotransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hisC PE=3 SV=1 455 833 4.0E-19
sp|P0A679|HIS8_MYCBO Histidinol-phosphate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisC PE=3 SV=1 455 833 4.0E-19
sp|O07131|HIS8_METFL Histidinol-phosphate aminotransferase OS=Methylobacillus flagellatus GN=hisC PE=3 SV=1 455 709 4.0E-19
sp|Q8DTQ4|HIS8_STRMU Histidinol-phosphate aminotransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisC PE=3 SV=1 455 833 4.0E-19
sp|A1KV06|HIS8_NEIMF Histidinol-phosphate aminotransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hisC PE=3 SV=1 493 834 4.0E-19
sp|Q9JTH8|HIS8_NEIMA Histidinol-phosphate aminotransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisC PE=3 SV=1 493 834 4.0E-19
sp|A9M185|HIS8_NEIM0 Histidinol-phosphate aminotransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=hisC PE=3 SV=1 493 834 4.0E-19
sp|F4JJL0|ENDO4_ARATH Endonuclease 4 OS=Arabidopsis thaliana GN=ENDO4 PE=3 SV=1 1 231 4.0E-19
sp|Q39YP6|HIS8_GEOMG Histidinol-phosphate aminotransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisC PE=1 SV=1 434 833 4.0E-19
sp|B9KDN6|HIS8_CAMLR Histidinol-phosphate aminotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=hisC PE=3 SV=1 494 834 6.0E-19
sp|A1BGB4|HIS8_CHLPD Histidinol-phosphate aminotransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisC PE=3 SV=1 494 830 7.0E-19
sp|Q8F6W9|HIS8_LEPIN Histidinol-phosphate aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisC PE=3 SV=1 496 834 8.0E-19
sp|Q72PG3|HIS8_LEPIC Histidinol-phosphate aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisC PE=3 SV=1 496 834 8.0E-19
sp|Q5X3Q5|HIS82_LEGPA Histidinol-phosphate aminotransferase 2 OS=Legionella pneumophila (strain Paris) GN=hisC2 PE=3 SV=1 455 705 8.0E-19
sp|Q7WDY3|HIS82_BORBR Histidinol-phosphate aminotransferase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisC2 PE=3 SV=1 493 835 1.0E-18
sp|P34037|HIS8_ZYMMO Histidinol-phosphate aminotransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisC PE=3 SV=3 434 827 1.0E-18
sp|Q5WV43|HIS82_LEGPL Histidinol-phosphate aminotransferase 2 OS=Legionella pneumophila (strain Lens) GN=hisC2 PE=3 SV=1 455 705 1.0E-18
sp|Q7W2Y3|HIS82_BORPA Histidinol-phosphate aminotransferase 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisC2 PE=3 SV=1 493 835 1.0E-18
sp|Q2J8K9|HIS8_FRASC Histidinol-phosphate aminotransferase OS=Frankia sp. (strain CcI3) GN=hisC PE=3 SV=1 434 834 1.0E-18
sp|A3Q130|HIS8_MYCSJ Histidinol-phosphate aminotransferase OS=Mycobacterium sp. (strain JLS) GN=hisC PE=3 SV=1 492 822 1.0E-18
sp|Q1QQD5|HIS8_NITHX Histidinol-phosphate aminotransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisC PE=3 SV=1 433 821 1.0E-18
sp|C1ATZ5|HIS8_RHOOB Histidinol-phosphate aminotransferase OS=Rhodococcus opacus (strain B4) GN=hisC PE=3 SV=1 455 822 2.0E-18
sp|Q7VSZ0|HIS82_BORPE Histidinol-phosphate aminotransferase 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisC2 PE=3 SV=1 493 835 2.0E-18
sp|Q2GAI1|HIS8_NOVAD Histidinol-phosphate aminotransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=hisC PE=3 SV=1 438 833 2.0E-18
sp|Q4FP52|HIS8_PELUB Histidinol-phosphate aminotransferase OS=Pelagibacter ubique (strain HTCC1062) GN=hisC PE=3 SV=1 455 720 2.0E-18
sp|Q5ZU10|HIS82_LEGPH Histidinol-phosphate aminotransferase 2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hisC2 PE=3 SV=2 455 705 2.0E-18
sp|A9H311|HIS8_GLUDA Histidinol-phosphate aminotransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hisC PE=3 SV=1 455 834 2.0E-18
sp|B1VP97|PATR_STRGG Putative phenylalanine aminotransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pat PE=3 SV=1 493 741 2.0E-18
sp|P61004|PATR_CORDI Putative phenylalanine aminotransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pat PE=3 SV=1 494 822 2.0E-18
sp|P61001|HIS8_MYCPA Histidinol-phosphate aminotransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisC PE=3 SV=1 455 711 3.0E-18
sp|A7H084|HIS8_CAMC5 Histidinol-phosphate aminotransferase OS=Campylobacter curvus (strain 525.92) GN=hisC PE=3 SV=1 496 719 3.0E-18
sp|A0QHI1|HIS8_MYCA1 Histidinol-phosphate aminotransferase OS=Mycobacterium avium (strain 104) GN=hisC PE=3 SV=1 455 711 3.0E-18
sp|Q131B9|HIS8_RHOPS Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=hisC PE=3 SV=1 433 828 3.0E-18
sp|Q04Z75|HIS8_LEPBL Histidinol-phosphate aminotransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=hisC PE=3 SV=1 455 834 3.0E-18
sp|Q04QW8|HIS8_LEPBJ Histidinol-phosphate aminotransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=hisC PE=3 SV=1 455 834 3.0E-18
sp|A2SSJ1|HIS8_METLZ Histidinol-phosphate aminotransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisC PE=3 SV=1 426 833 3.0E-18
sp|A6QBY8|HIS8_SULNB Histidinol-phosphate aminotransferase OS=Sulfurovum sp. (strain NBC37-1) GN=hisC PE=3 SV=1 494 718 4.0E-18
sp|Q1GP30|HIS8_SPHAL Histidinol-phosphate aminotransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hisC PE=3 SV=1 435 822 4.0E-18
sp|Q1B7G5|HIS8_MYCSS Histidinol-phosphate aminotransferase OS=Mycobacterium sp. (strain MCS) GN=hisC PE=3 SV=1 492 822 4.0E-18
sp|A1UHK7|HIS8_MYCSK Histidinol-phosphate aminotransferase OS=Mycobacterium sp. (strain KMS) GN=hisC PE=3 SV=1 492 822 4.0E-18
sp|Q9HQS0|HIS8_HALSA Histidinol-phosphate aminotransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisC PE=3 SV=3 450 833 4.0E-18
sp|B0R4Q4|HIS8_HALS3 Histidinol-phosphate aminotransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisC PE=3 SV=1 450 833 4.0E-18
sp|Q970Z4|HIS8_SULTO Histidinol-phosphate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisC PE=3 SV=2 426 835 5.0E-18
sp|Q9SXA6|ENDO1_ARATH Endonuclease 1 OS=Arabidopsis thaliana GN=ENDO1 PE=1 SV=1 4 262 5.0E-18
sp|A6Q1Z5|HIS8_NITSB Histidinol-phosphate aminotransferase OS=Nitratiruptor sp. (strain SB155-2) GN=hisC PE=3 SV=1 455 837 5.0E-18
sp|Q5FQA6|HIS82_GLUOX Histidinol-phosphate aminotransferase 2 OS=Gluconobacter oxydans (strain 621H) GN=hisC2 PE=3 SV=1 438 816 7.0E-18
sp|B4U9L1|HIS8_HYDS0 Histidinol-phosphate aminotransferase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=hisC PE=3 SV=1 478 833 9.0E-18
sp|Q9ZBY8|PATR_STRCO Putative phenylalanine aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pat PE=3 SV=1 493 835 1.0E-17
sp|A1TGS6|PATR_MYCVP Putative phenylalanine aminotransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pat PE=3 SV=1 434 709 1.0E-17
sp|Q0SHX9|HIS8_RHOJR Histidinol-phosphate aminotransferase OS=Rhodococcus jostii (strain RHA1) GN=hisC PE=3 SV=1 455 822 1.0E-17
sp|B1L869|HIS8_THESQ Histidinol-phosphate aminotransferase OS=Thermotoga sp. (strain RQ2) GN=hisC PE=3 SV=1 442 835 1.0E-17
sp|A5INE2|HIS8_THEP1 Histidinol-phosphate aminotransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=hisC PE=3 SV=1 442 835 1.0E-17
sp|A0QX82|HIS8_MYCS2 Histidinol-phosphate aminotransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisC PE=3 SV=1 434 822 1.0E-17
sp|Q82FJ1|PATR_STRAW Putative phenylalanine aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pat PE=3 SV=1 493 835 2.0E-17
sp|B0UN04|HIS8_METS4 Histidinol-phosphate aminotransferase OS=Methylobacterium sp. (strain 4-46) GN=hisC PE=3 SV=1 430 835 2.0E-17
sp|Q92L21|HIS82_RHIME Histidinol-phosphate aminotransferase 2 OS=Rhizobium meliloti (strain 1021) GN=hisC2 PE=3 SV=1 436 706 2.0E-17
sp|P55683|HIS8_RHISN Histidinol-phosphate aminotransferase OS=Rhizobium sp. (strain NGR234) GN=hisC PE=3 SV=1 455 824 2.0E-17
sp|Q9X0D0|HIS8_THEMA Histidinol-phosphate aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisC PE=1 SV=1 442 835 2.0E-17
sp|Q0W253|HIS8_METAR Histidinol-phosphate aminotransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisC PE=3 SV=1 455 833 3.0E-17
sp|Q98B00|HIS83_RHILO Histidinol-phosphate aminotransferase 3 OS=Rhizobium loti (strain MAFF303099) GN=hisC3 PE=3 SV=1 462 833 4.0E-17
sp|Q8LDW6|ENDO3_ARATH Endonuclease 3 OS=Arabidopsis thaliana GN=ENDO3 PE=2 SV=1 5 219 4.0E-17
sp|Q0C348|HIS8_HYPNA Histidinol-phosphate aminotransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisC PE=3 SV=1 492 834 5.0E-17
sp|Q5N4R3|HIS8_SYNP6 Histidinol-phosphate aminotransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisC PE=3 SV=1 494 830 6.0E-17
sp|Q31PF9|HIS8_SYNE7 Histidinol-phosphate aminotransferase OS=Synechococcus elongatus (strain PCC 7942) GN=hisC PE=3 SV=1 494 745 6.0E-17
sp|Q11DR9|HIS8_CHESB Histidinol-phosphate aminotransferase OS=Chelativorans sp. (strain BNC1) GN=hisC PE=3 SV=1 435 835 7.0E-17
sp|Q92MG0|HIS81_RHIME Histidinol-phosphate aminotransferase 1 OS=Rhizobium meliloti (strain 1021) GN=hisC1 PE=3 SV=1 461 832 1.0E-16
sp|Q5Z3C0|PATR_NOCFA Putative phenylalanine aminotransferase OS=Nocardia farcinica (strain IFM 10152) GN=pat PE=3 SV=1 494 824 1.0E-16
sp|Q47GP2|HIS81_DECAR Histidinol-phosphate aminotransferase 1 OS=Dechloromonas aromatica (strain RCB) GN=hisC1 PE=3 SV=1 455 709 1.0E-16
sp|B1MFC0|PATR_MYCA9 Putative phenylalanine aminotransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pat PE=3 SV=1 434 705 2.0E-16
sp|Q6ABX6|PATR_LEIXX Putative phenylalanine aminotransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pat PE=3 SV=1 434 828 2.0E-16
sp|Q2N7G6|HIS8_ERYLH Histidinol-phosphate aminotransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=hisC PE=3 SV=1 434 833 2.0E-16
sp|Q5WGR9|HIS8_BACSK Histidinol-phosphate aminotransferase OS=Bacillus clausii (strain KSM-K16) GN=hisC PE=3 SV=1 455 834 2.0E-16
sp|Q3JEN8|HIS81_NITOC Histidinol-phosphate aminotransferase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisC1 PE=3 SV=1 454 837 2.0E-16
sp|Q98G10|HIS82_RHILO Histidinol-phosphate aminotransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=hisC2 PE=3 SV=1 435 835 3.0E-16
sp|Q8EXQ7|COBDQ_LEPIN Adenosylcobalamin biosynthesis bifunctional protein CobDQ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cobDQ PE=3 SV=2 492 834 3.0E-16
sp|A8MEH2|HIS8_ALKOO Histidinol-phosphate aminotransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hisC PE=3 SV=1 457 723 3.0E-16
sp|Q39M27|HIS83_BURL3 Histidinol-phosphate aminotransferase 3 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisC3 PE=3 SV=1 494 823 4.0E-16
sp|Q5FRR4|HIS81_GLUOX Histidinol-phosphate aminotransferase 1 OS=Gluconobacter oxydans (strain 621H) GN=hisC1 PE=3 SV=1 457 719 7.0E-16
sp|Q8DM42|HIS8_THEEB Histidinol-phosphate aminotransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=hisC PE=3 SV=1 478 830 7.0E-16
sp|Q9A5B6|HIS82_CAUCR Histidinol-phosphate aminotransferase 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisC2 PE=3 SV=1 494 709 7.0E-16
sp|Q8FU28|PATR_COREF Putative phenylalanine aminotransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pat PE=3 SV=2 433 709 1.0E-15
sp|A8HZS2|HIS8_AZOC5 Histidinol-phosphate aminotransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisC PE=3 SV=1 435 830 1.0E-15
sp|Q47KH1|PATR_THEFY Putative phenylalanine aminotransferase OS=Thermobifida fusca (strain YX) GN=pat PE=3 SV=1 434 708 1.0E-15
sp|P61005|PATR_MYCPA Putative phenylalanine aminotransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pat PE=3 SV=1 434 795 1.0E-15
sp|A0Q9F3|PATR_MYCA1 Putative phenylalanine aminotransferase OS=Mycobacterium avium (strain 104) GN=pat PE=3 SV=1 434 795 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0004519 endonuclease activity Yes
GO:0009058 biosynthetic process Yes
GO:0006308 DNA catabolic process Yes
GO:0003676 nucleic acid binding Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0005488 binding No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044265 cellular macromolecule catabolic process No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0009056 catabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0008152 metabolic process No
GO:1901575 organic substance catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0070279 vitamin B6 binding No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0019842 vitamin binding No
GO:0043168 anion binding No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0019439 aromatic compound catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|730750
MRPTRLQSLAILTGLTTLPSTFAWGAAGHEIVATLAQIYTQPDVLDKICSILNAYTDLEDQIHEDEFSMTTTHKC
HLASIATWADKLKYRMRWSAPLHYVNAVGDHPSDICVFPGPEGWSGKPNINVLGGIYNTSNILLEYAQGEDERVM
DVGLAQEALKFIVHFIGDMHMPLHLVGRDKGGNGVEVCWEGRRRKFHSVWDNYIVAKAIRDTGNNYSRPLPGGYE
PVERHLRGAIYDPYIRRIIWEGVEGRWVEDLDGWLDCPKVDEDARKEAVKKGVFATLGNVFLPGWLTNWGTAETT
VTDTDAICPYHWAKPIHALNCELLWPKEMDEPFSGTSAHRRPRCKRWSEEEQREVVDIDEEPPYELDNPDYMTPI
QERMLLEQFLAQGGTILSYLSHLITKHDSSFFKETIMPIHGLKSLGKVNPPHFNIENVIRPNILSLHPYRCARDD
YSEGILLDANENALGHSIPKPTSSSNTEEGLTADLVDTLDLDLHRYPDPSHPKIKSRIAALRGLPSTEYVFLGVG
SDEVIDLLMRVCVVPGKEKIVITPPTYGMYAVCAQVNDVGVVKVPLELSNVNGEGGDQGRFSVRVDEVLETTAAD
SNIKLIFLCSPGNPTSTLISLTSIHTICSSPTFKGILVVDEAYIDFASSSSSSKPVSAVSLIQDYSNLVVLQTLS
KSFGLAAIRLGIALAQPPLIQILSNTKAPYNISTPTAHLALTALSPTSITGMQNKVMNLVKNRSSLLDRLFNSEG
TKYNLGKPIGAGDGNFIMVPVLSKDGSGKKDNERAQRVYKVLAEENGLVVRFRGNEVGCEACLRITVGTEEEIEE
VVERMGKVFKYY*
Coding >Agabi119p4|730750
ATGCGGCCGACCCGTCTCCAATCTCTTGCCATCTTAACTGGCTTAACCACCCTACCCAGCACCTTCGCATGGGGA
GCAGCTGGACACGAAATTGTCGCCACTCTCGCGCAAATCTACACTCAACCTGACGTGTTAGACAAGATCTGTAGC
ATTCTAAACGCGTACACGGATCTAGAAGATCAAATTCACGAAGATGAATTCTCTATGACCACGACGCATAAATGT
CATCTCGCGTCCATCGCAACTTGGGCAGACAAGTTGAAATATCGGATGCGTTGGTCTGCACCTCTACACTATGTC
AATGCTGTTGGTGATCATCCATCTGATATTTGCGTGTTTCCTGGTCCGGAAGGATGGTCAGGAAAACCGAATATC
AATGTTTTGGGAGGGATCTACAATACGTCGAATATCCTTTTGGAGTATGCTCAAGGTGAAGATGAGCGTGTTATG
GATGTTGGACTTGCTCAAGAAGCGCTCAAATTCATTGTTCATTTCATCGGTGATATGCATATGCCATTGCATCTC
GTTGGAAGAGATAAAGGAGGAAATGGTGTTGAGGTATGTTGGGAAGGCAGAAGAAGAAAGTTCCATTCGGTATGG
GACAATTATATTGTGGCAAAGGCTATACGCGATACCGGGAACAATTATTCGAGACCATTACCTGGAGGATATGAA
CCAGTGGAAAGGCATTTGAGGGGAGCGATTTATGATCCCTATATTCGGAGGATCATTTGGGAAGGTGTAGAGGGG
AGATGGGTGGAGGATTTGGATGGGTGGCTTGATTGTCCAAAGGTGGATGAGGATGCCAGGAAGGAAGCCGTCAAG
AAGGGAGTTTTCGCAACGCTTGGAAACGTTTTCCTCCCGGGTTGGCTTACGAACTGGGGTACTGCGGAGACTACG
GTGACAGATACGGACGCTATATGCCCATACCATTGGGCAAAGCCCATTCACGCTTTGAATTGTGAACTTTTATGG
CCCAAGGAGATGGATGAACCATTTAGTGGTACATCTGCTCATCGCAGGCCGAGGTGCAAGCGGTGGAGTGAGGAA
GAGCAAAGGGAGGTTGTTGATATCGACGAGGAACCTCCCTATGAACTTGATAACCCTGACTATATGACACCTATC
CAGGAACGGATGCTTCTCGAACAGTTTTTGGCTCAAGGAGGTACAATCTTATCTTATCTCTCACACCTTATCACG
AAACATGACTCCTCTTTTTTCAAAGAAACTATAATGCCCATCCACGGTCTCAAGTCATTGGGCAAAGTCAATCCT
CCCCACTTTAACATTGAAAACGTCATTCGCCCGAACATACTTTCATTACACCCTTATAGATGTGCTCGCGACGAT
TACAGTGAAGGTATCCTCCTCGACGCCAACGAAAATGCTCTCGGACATTCCATACCCAAACCCACGAGTAGTAGT
AATACAGAAGAAGGCTTGACAGCTGATTTGGTTGATACACTCGACCTCGACTTGCATCGCTACCCCGACCCTTCT
CATCCCAAAATCAAATCTCGAATTGCGGCTTTACGTGGATTACCTTCTACGGAATATGTGTTTTTGGGTGTGGGT
TCCGATGAAGTTATTGATTTGTTGATGAGGGTGTGTGTGGTTCCTGGAAAGGAGAAGATAGTGATTACGCCGCCG
ACTTATGGGATGTATGCTGTTTGTGCTCAGGTGAATGATGTGGGTGTGGTTAAAGTTCCTTTGGAATTGAGTAAT
GTGAATGGAGAGGGAGGTGATCAAGGAAGGTTTAGTGTTCGTGTAGACGAGGTTCTTGAAACTACAGCTGCAGAT
TCAAACATCAAACTCATCTTCCTCTGCTCACCCGGAAACCCAACTTCAACTCTCATATCCCTAACCTCCATCCAC
ACCATCTGTTCTTCACCCACCTTCAAAGGCATCCTCGTCGTAGACGAAGCCTACATCGATTTCGCATCTTCCTCC
TCCTCTTCCAAACCCGTCTCGGCAGTATCTCTAATCCAAGACTATTCAAACCTAGTGGTACTTCAAACTCTATCC
AAATCATTCGGACTGGCTGCTATTCGATTGGGAATTGCTTTAGCTCAACCCCCTTTGATTCAAATTCTTTCTAAT
ACGAAAGCACCCTATAACATCTCGACGCCTACAGCTCATTTGGCACTCACCGCACTCTCACCAACGTCCATTACG
GGAATGCAGAATAAAGTGATGAATCTAGTGAAAAATCGCTCTTCTCTTCTAGACAGGCTCTTCAACTCAGAAGGC
ACGAAATACAATTTGGGTAAACCCATAGGCGCAGGTGACGGAAACTTTATCATGGTACCCGTGTTGAGCAAAGAT
GGGTCGGGAAAAAAGGATAATGAACGAGCTCAGAGAGTATACAAGGTTTTGGCAGAGGAGAATGGGCTCGTGGTG
AGATTTAGAGGGAATGAGGTGGGATGCGAGGCATGTTTGAGGATTACGGTTGGGACTGAAGAGGAGATTGAGGAG
GTTGTAGAGCGTATGGGAAAAGTTTTCAAGTATTATTAG
Transcript >Agabi119p4|730750
ATGCGGCCGACCCGTCTCCAATCTCTTGCCATCTTAACTGGCTTAACCACCCTACCCAGCACCTTCGCATGGGGA
GCAGCTGGACACGAAATTGTCGCCACTCTCGCGCAAATCTACACTCAACCTGACGTGTTAGACAAGATCTGTAGC
ATTCTAAACGCGTACACGGATCTAGAAGATCAAATTCACGAAGATGAATTCTCTATGACCACGACGCATAAATGT
CATCTCGCGTCCATCGCAACTTGGGCAGACAAGTTGAAATATCGGATGCGTTGGTCTGCACCTCTACACTATGTC
AATGCTGTTGGTGATCATCCATCTGATATTTGCGTGTTTCCTGGTCCGGAAGGATGGTCAGGAAAACCGAATATC
AATGTTTTGGGAGGGATCTACAATACGTCGAATATCCTTTTGGAGTATGCTCAAGGTGAAGATGAGCGTGTTATG
GATGTTGGACTTGCTCAAGAAGCGCTCAAATTCATTGTTCATTTCATCGGTGATATGCATATGCCATTGCATCTC
GTTGGAAGAGATAAAGGAGGAAATGGTGTTGAGGTATGTTGGGAAGGCAGAAGAAGAAAGTTCCATTCGGTATGG
GACAATTATATTGTGGCAAAGGCTATACGCGATACCGGGAACAATTATTCGAGACCATTACCTGGAGGATATGAA
CCAGTGGAAAGGCATTTGAGGGGAGCGATTTATGATCCCTATATTCGGAGGATCATTTGGGAAGGTGTAGAGGGG
AGATGGGTGGAGGATTTGGATGGGTGGCTTGATTGTCCAAAGGTGGATGAGGATGCCAGGAAGGAAGCCGTCAAG
AAGGGAGTTTTCGCAACGCTTGGAAACGTTTTCCTCCCGGGTTGGCTTACGAACTGGGGTACTGCGGAGACTACG
GTGACAGATACGGACGCTATATGCCCATACCATTGGGCAAAGCCCATTCACGCTTTGAATTGTGAACTTTTATGG
CCCAAGGAGATGGATGAACCATTTAGTGGTACATCTGCTCATCGCAGGCCGAGGTGCAAGCGGTGGAGTGAGGAA
GAGCAAAGGGAGGTTGTTGATATCGACGAGGAACCTCCCTATGAACTTGATAACCCTGACTATATGACACCTATC
CAGGAACGGATGCTTCTCGAACAGTTTTTGGCTCAAGGAGGTACAATCTTATCTTATCTCTCACACCTTATCACG
AAACATGACTCCTCTTTTTTCAAAGAAACTATAATGCCCATCCACGGTCTCAAGTCATTGGGCAAAGTCAATCCT
CCCCACTTTAACATTGAAAACGTCATTCGCCCGAACATACTTTCATTACACCCTTATAGATGTGCTCGCGACGAT
TACAGTGAAGGTATCCTCCTCGACGCCAACGAAAATGCTCTCGGACATTCCATACCCAAACCCACGAGTAGTAGT
AATACAGAAGAAGGCTTGACAGCTGATTTGGTTGATACACTCGACCTCGACTTGCATCGCTACCCCGACCCTTCT
CATCCCAAAATCAAATCTCGAATTGCGGCTTTACGTGGATTACCTTCTACGGAATATGTGTTTTTGGGTGTGGGT
TCCGATGAAGTTATTGATTTGTTGATGAGGGTGTGTGTGGTTCCTGGAAAGGAGAAGATAGTGATTACGCCGCCG
ACTTATGGGATGTATGCTGTTTGTGCTCAGGTGAATGATGTGGGTGTGGTTAAAGTTCCTTTGGAATTGAGTAAT
GTGAATGGAGAGGGAGGTGATCAAGGAAGGTTTAGTGTTCGTGTAGACGAGGTTCTTGAAACTACAGCTGCAGAT
TCAAACATCAAACTCATCTTCCTCTGCTCACCCGGAAACCCAACTTCAACTCTCATATCCCTAACCTCCATCCAC
ACCATCTGTTCTTCACCCACCTTCAAAGGCATCCTCGTCGTAGACGAAGCCTACATCGATTTCGCATCTTCCTCC
TCCTCTTCCAAACCCGTCTCGGCAGTATCTCTAATCCAAGACTATTCAAACCTAGTGGTACTTCAAACTCTATCC
AAATCATTCGGACTGGCTGCTATTCGATTGGGAATTGCTTTAGCTCAACCCCCTTTGATTCAAATTCTTTCTAAT
ACGAAAGCACCCTATAACATCTCGACGCCTACAGCTCATTTGGCACTCACCGCACTCTCACCAACGTCCATTACG
GGAATGCAGAATAAAGTGATGAATCTAGTGAAAAATCGCTCTTCTCTTCTAGACAGGCTCTTCAACTCAGAAGGC
ACGAAATACAATTTGGGTAAACCCATAGGCGCAGGTGACGGAAACTTTATCATGGTACCCGTGTTGAGCAAAGAT
GGGTCGGGAAAAAAGGATAATGAACGAGCTCAGAGAGTATACAAGGTTTTGGCAGAGGAGAATGGGCTCGTGGTG
AGATTTAGAGGGAATGAGGTGGGATGCGAGGCATGTTTGAGGATTACGGTTGGGACTGAAGAGGAGATTGAGGAG
GTTGTAGAGCGTATGGGAAAAGTTTTCAAGTATTATTAG
Gene >Agabi119p4|730750
ATGCGGCCGACCCGTCTCCAATCTCTTGCCATCTTAACTGGCTTAACCACCCTACCCAGCACCTTCGCATGGGGA
GCAGCTGGACACGAAATTGTCGCCACTCTCGCGCAAATCTACACTCAACCTGACGTGTTAGACAAGATCTGTAGC
ATTCTAAACGCGTACACGGATCTAGAAGATCAAATTCACGAAGATGAATTCTCTATGACCACGACGCATAAATGT
CATCTCGCGTCCATCGCAACTTGGGCAGACAAGTTGAAATATCGGATGCGTTGGTCTGCACCTCTACACTATGTC
AATGCTGTTGGTGATCATCCATCTGATATTTGCGTGTTTCCTGGTCCGGAAGGATGGTCAGGAAAACCGAATATC
AATGTTTTGGGAGGGATCTACAATACGTCGAATATCCTTTTGGAGTATGCTCAAGGTGAAGATGAGCGTGTTATG
GATGTTGGACTTGCTCAAGAAGCGCTCAAATTCATTGTTCATTTCATCGGTGATATGCATATGCCATTGCATCTC
GTTGGAAGAGATAAAGGAGGAAATGGTGTTGAGGTATGTTGGGAAGGCAGAAGAAGAAAGTTCCATTCGGTATGG
GACAATTATATTGTGGCAAAGGCTATACGCGATACCGGGAACAATTATTCGAGACCATTACCTGGAGGATATGAA
CCAGTGGAAAGGCATTTGAGGGGAGCGATTTATGATCCCTATATTCGGAGGATCATTTGGGAAGGTGTAGAGGGG
AGATGGGTGGAGGATTTGGATGGGTGGCTTGATTGTCCAAAGGTGGATGAGGATGCCAGGAAGGAAGCCGTCAAG
AAGGGAGTTTTCGCAACGCTTGGAAACGTTTTCCTCCCGGGTTGGCTTACGAACTGGGGTACTGCGGAGACTACG
GTGACAGATACGGACGCTATATGCCCATACCATTGGGCAAAGCCCATTCACGCTTTGAATTGTGAACTTTTATGG
CCCAAGGAGATGGATGAACCATTTAGTGGTACATCTGCTCATCGCAGGCCGAGGTGCAAGCGGTGGAGTGAGGAA
GAGCAAAGGGAGGTTGTTGATATCGACGAGGAACCTCCCTATGAACTTGATAACCCTGACTATATGACACCTATC
CAGGAACGGATGCTTCTCGAACAGTTTTTGGCTCAAGGAGGTGTGCGTCTGGCTGGAGTGTTGAATTATATTTTT
GCAGACAGGAGGATATGAACTACAATCTTATCGTTACAGACAATCTTATCTTATCTCTCACACCTTATCACGAAA
CATGACTCCTCTTTTTTCAAAGAAACTATAATGCCCATCCACGGTCTCAAGTCATTGGGCAAAGTCAATCCTCCC
CACTTTAACATTGAAAACGTCATTCGCCCGAACATACTTTCATTACACCCTTATAGATGTGCTCGCGACGATTAC
AGTGAAGGTATCCTCCTCGACGCCAACGAAAATGCTCTCGGACATTCCATACCCAAACCCACGAGTAGTAGTAAT
ACAGAAGAAGGCTTGACAGCTGATTTGGTTGATACACTCGACCTCGACTTGCATCGCTACCCCGACCCTTCTCAT
CCCAAAATCAAATCTCGAATTGCGGCTTTACGTGGATTACCTTCTACGGAATATGTGTTTTTGGGTGTGGGTTCC
GATGAAGTTATTGATTTGTTGATGAGGGTGTGTGTGGTTCCTGGAAAGGAGAAGATAGTGATTACGCCGCCGACT
TATGGGATGTATGCTGTTTGTGCTCAGGTGAATGATGTGGGTGTGGTTAAAGTTCCTTTGGAATTGAGTAATGTG
AATGGAGAGGGAGGTGATCAAGGAAGGTTTAGTGTTCGTGTAGACGAGGTATTCTCTTTTTTCTCAATTCAAGGC
GGTCAAATTGAGACAGTTATTAGGTTCTTGAAACTACAGCTGCAGATTCAAACATCAAACTCATCTTCCTCTGCT
CACCCGGAAACCCAACTTCAACTCTCATATCCCTAACCTCCATCCACACCATCTGTTCTTCACCCACCTTCAAAG
GCATCCTCGTCGTAGACGAAGCCTACATCGATTTCGCATCTTCCTCCTCCTCTTCCAAACCCGTCTCGGCAGTAT
CTCTAATCCAAGACTATTCAAACCTAGTGGTACTTCAAACTCTATCCAAATCATTCGGACTGGCTGCTATTCGAT
TGGGAATTGCTTTAGCTCAACCCCCTTTGATTCAAATTCTTTCTAATACGAAAGCACCCTATAACATCTCGACGC
CTACAGCTCATTTGGCACTCACCGCACTCTCACCAACGTCCATTACGGGAATGCAGAATAAAGTGATGAATCTAG
TGAAAAATCGCTCTTCTCTTCTAGACAGGCTCTTCAACTCAGAAGGCACGAAATACAATTTGGGTAAACCCATAG
GCGCAGGTGACGGAAACTTTATCATGGTACCCGTGTTGAGCAAAGATGGGTCGGGAAAAAAGGATAATGAACGAG
CTCAGAGAGTATACAAGGTTTTGGCAGAGGAGAATGGGCTCGTGGTGAGATTTAGAGGGAATGAGGTGGGATGCG
AGGCATGTTTGAGGATTACGGTTGGGACTGAAGAGGAGATTGAGGAGGTTGTAGAGCGTATGGGAAAAGTTTTCA
AGTATTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail