Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|730350
Gene name
Locationscaffold_10:559818..560606
Strand+
Gene length (bp)788
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 1.0E-22 82 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O05213|YBBE_BACSU UPF0214 protein YbbE OS=Bacillus subtilis (strain 168) GN=ybbE PE=3 SV=3 82 196 7.0E-08
sp|B5BB26|YFEW_SALPK UPF0214 protein YfeW OS=Salmonella paratyphi A (strain AKU_12601) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|Q5PCQ2|YFEW_SALPA UPF0214 protein YfeW OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|B5RCU8|YFEW_SALG2 UPF0214 protein YfeW OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|Q8Z4S7|YFEW_SALTI UPF0214 protein YfeW OS=Salmonella typhi GN=yfeW PE=3 SV=1 76 189 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O05213|YBBE_BACSU UPF0214 protein YbbE OS=Bacillus subtilis (strain 168) GN=ybbE PE=3 SV=3 82 196 7.0E-08
sp|B5BB26|YFEW_SALPK UPF0214 protein YfeW OS=Salmonella paratyphi A (strain AKU_12601) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|Q5PCQ2|YFEW_SALPA UPF0214 protein YfeW OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|B5RCU8|YFEW_SALG2 UPF0214 protein YfeW OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|Q8Z4S7|YFEW_SALTI UPF0214 protein YfeW OS=Salmonella typhi GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|B4TR50|YFEW_SALSV UPF0214 protein YfeW OS=Salmonella schwarzengrund (strain CVM19633) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|C0PZ64|YFEW_SALPC UPF0214 protein YfeW OS=Salmonella paratyphi C (strain RKS4594) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|A9N307|YFEW_SALPB UPF0214 protein YfeW OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|B4T0K5|YFEW_SALNS UPF0214 protein YfeW OS=Salmonella newport (strain SL254) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|B5R4I5|YFEW_SALEP UPF0214 protein YfeW OS=Salmonella enteritidis PT4 (strain P125109) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|B5FQG8|YFEW_SALDC UPF0214 protein YfeW OS=Salmonella dublin (strain CT_02021853) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|Q57LN2|YFEW_SALCH UPF0214 protein YfeW OS=Salmonella choleraesuis (strain SC-B67) GN=yfeW PE=3 SV=1 76 189 2.0E-07
sp|B4TD53|YFEW_SALHS UPF0214 protein YfeW OS=Salmonella heidelberg (strain SL476) GN=yfeW PE=3 SV=1 76 189 3.0E-07
sp|Q8ZN80|YFEW_SALTY UPF0214 protein YfeW OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yfeW PE=3 SV=1 76 189 3.0E-07
sp|Q9KX40|ESTB_BURGA Esterase EstB OS=Burkholderia gladioli GN=estB PE=1 SV=1 84 184 8.0E-06
sp|P77619|YFEW_ECOLI UPF0214 protein YfeW OS=Escherichia coli (strain K12) GN=yfeW PE=3 SV=2 76 189 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|730350
MIFNTFKLNLCGTILLSTLVALASSKETDTLKKLTFNSAGSLLLPNGIVNPDALRELEENITGYTVPANYGSASF
NQVRPLYPGAVALVANEGTVVSHFSTGYSYKYADADGTLLPQSEWVTLGKDDIFDMASLTKMFTTILAMQQLDKG
AFGLNDPVVTHLPGLDGGKEDVTVQMLMTHTSGFDADPDPGLWYGYVVF*
Coding >Agabi119p4|730350
ATGATCTTCAACACGTTCAAATTAAACCTCTGTGGCACTATTCTATTATCAACGCTCGTCGCTTTGGCTTCTTCA
AAAGAAACGGACACACTCAAGAAATTGACTTTTAACAGTGCAGGATCATTATTATTACCAAATGGAATCGTCAAT
CCAGACGCTTTACGAGAATTAGAAGAGAACATAACGGGGTATACTGTACCTGCGAATTATGGATCGGCGAGTTTT
AATCAAGTTCGTCCGTTATATCCTGGTGCTGTCGCCTTGGTTGCAAATGAAGGCACTGTTGTATCGCATTTCAGT
ACTGGATATTCGTACAAGTATGCAGATGCTGATGGAACTCTGTTACCTCAATCCGAGTGGGTCACATTGGGAAAA
GATGATATTTTCGACATGGCATCGTTGACCAAGATGTTTACGACGATCCTGGCGATGCAACAACTTGATAAAGGC
GCTTTTGGTTTGAATGATCCCGTGGTCACACATTTGCCTGGACTTGATGGTGGAAAGGAAGATGTTACGGTCCAA
ATGTTGATGACACATACATCGGGGTTTGACGCGGATCCGGATCCTGGATTGTGGTATGGGTATGTTGTGTTTTGA
Transcript >Agabi119p4|730350
ATGATCTTCAACACGTTCAAATTAAACCTCTGTGGCACTATTCTATTATCAACGCTCGTCGCTTTGGCTTCTTCA
AAAGAAACGGACACACTCAAGAAATTGACTTTTAACAGTGCAGGATCATTATTATTACCAAATGGAATCGTCAAT
CCAGACGCTTTACGAGAATTAGAAGAGAACATAACGGGGTATACTGTACCTGCGAATTATGGATCGGCGAGTTTT
AATCAAGTTCGTCCGTTATATCCTGGTGCTGTCGCCTTGGTTGCAAATGAAGGCACTGTTGTATCGCATTTCAGT
ACTGGATATTCGTACAAGTATGCAGATGCTGATGGAACTCTGTTACCTCAATCCGAGTGGGTCACATTGGGAAAA
GATGATATTTTCGACATGGCATCGTTGACCAAGATGTTTACGACGATCCTGGCGATGCAACAACTTGATAAAGGC
GCTTTTGGTTTGAATGATCCCGTGGTCACACATTTGCCTGGACTTGATGGTGGAAAGGAAGATGTTACGGTCCAA
ATGTTGATGACACATACATCGGGGTTTGACGCGGATCCGGATCCTGGATTGTGGTATGGGTATGTTGTGTTTTGA
Gene >Agabi119p4|730350
ATGATCTTCAACACGTTCAAATTAAACCTCTGTGGCACTATTCTATTATCAACGCTCGTCGCTTTGGCTTCTTCA
AAAGAAACGGACACACTCAAGAAATTGACTTTTAACAGTGCAGGATCATTATTATTACCAAATGGAATCGTCAAT
CCAGACGCTTTACGAGAATTAGAAGAGAACATAACGGGGTATACTGTACCTGCGAATTATGGATCGGCGAGTTTT
AATCAAGTTCGTCCGTTATATCCTGGTGCTGTCGCCTTGTGAGTTGTTTGTTTCTCTCTCTCACATTGATGATGA
CGATACTGATGATGATGATGGCGGTGATGATGACGAAGGGTTGCAAATGAAGGCACTGTTGTATCGCATTTCAGT
ACTGGATATTCGTACAAGTATGCAGATGCTGATGGAACTCTGTTACCTCAATCCGAGTGGGTCACATTGGGAAAA
GATGATATTTTCGACAGTATGTTTTCTTTTTTTATTCCCTTTCTCTCTCTCTCTCTTTTTAAAGATTATATGTAG
TGGCATCGTTGACCAAGATGTTTACGACGATCCTGGCGATGCAACAACTTGATAAAGGCGCTTTTGGTTTGAATG
ATCCCGTGGTCACACATTTGCCTGGACTTGATGGTGAGTGCGTTTTTGGAGTTGTGAGGCTGAACGTTTATTTTT
GATGATGGATAGGTGGAAAGGAAGATGTTACGGTCCAAATGTTGATGACACATACATCGGGGTTTGACGCGGATC
CGGATCCTGGATTGTGGTATGGGTATGTTGTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail