Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|725300
Gene name
Locationscaffold_09:1816782..1820963
Strand+
Gene length (bp)4181
Transcript length (bp)4059
Coding sequence length (bp)4059
Protein length (aa) 1353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 3.0E-37 776 878
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 9.0E-37 748 844
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 6.7E-18 523 682
PF17921 Integrase_H2C2 Integrase zinc binding domain 5.4E-18 992 1048
PF00665 rve Integrase core domain 5.4E-12 1066 1162
PF08284 RVP_2 Retroviral aspartyl protease 9.0E-10 301 400
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 9.0E-08 294 385
PF13650 Asp_protease_2 Aspartyl protease 2.8E-07 293 383
PF03732 Retrotrans_gag Retrotransposon gag protein 6.3E-07 57 127
PF00098 zf-CCHC Zinc knuckle 3.6E-04 235 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 298 1337 3.0E-137
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 298 1337 3.0E-137
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 298 1337 3.0E-137
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 298 1337 3.0E-137
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 298 1337 6.0E-137
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 298 1337 6.0E-137
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 298 1337 7.0E-137
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 486 1315 8.0E-127
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 486 1315 2.0E-125
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 459 1215 2.0E-84
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 459 1218 2.0E-82
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 360 899 4.0E-67
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 314 898 4.0E-59
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 467 901 2.0E-55
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 287 898 4.0E-41
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 297 898 1.0E-40
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 297 898 3.0E-40
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 297 898 7.0E-40
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 481 898 9.0E-40
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 285 898 1.0E-38
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 299 896 1.0E-38
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 236 898 1.0E-34
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 236 898 2.0E-34
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 298 893 1.0E-33
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 488 900 2.0E-31
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 298 893 3.0E-29
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 490 904 1.0E-28
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 298 892 1.0E-27
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 978 1312 4.0E-27
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 919 1308 2.0E-26
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 481 882 6.0E-24
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 479 932 1.0E-23
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 301 898 7.0E-23
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 481 811 8.0E-23
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 975 1241 2.0E-22
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 469 898 2.0E-22
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 514 852 4.0E-22
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 479 828 4.0E-22
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 479 828 4.0E-22
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 479 828 5.0E-22
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 479 828 8.0E-22
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 477 828 8.0E-22
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 479 828 1.0E-21
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 983 1239 2.0E-21
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 509 898 2.0E-21
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 467 833 2.0E-21
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 479 828 3.0E-21
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 983 1239 5.0E-21
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 479 828 5.0E-21
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 984 1241 6.0E-21
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 479 828 7.0E-21
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 479 834 9.0E-21
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 236 727 2.0E-20
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 949 1239 3.0E-20
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 467 833 4.0E-19
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 467 833 5.0E-19
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 999 1267 9.0E-19
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 529 625 3.0E-18
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 973 1263 7.0E-17
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 973 1263 7.0E-17
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 287 833 1.0E-16
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 1087 1303 2.0E-16
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 982 1263 2.0E-16
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 287 833 4.0E-16
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 973 1263 6.0E-16
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 655 797 9.0E-16
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 1087 1303 2.0E-15
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 1087 1303 2.0E-15
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 1087 1303 2.0E-15
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 1072 1303 2.0E-15
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 1087 1303 3.0E-15
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 1087 1303 3.0E-15
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 1087 1303 4.0E-15
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 973 1218 4.0E-15
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 1087 1303 5.0E-15
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 982 1309 7.0E-15
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 1087 1303 2.0E-14
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 1063 1303 3.0E-14
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 236 576 2.0E-13
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 958 1303 2.0E-12
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 686 811 2.0E-12
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 56 401 1.0E-11
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 207 642 7.0E-11
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 982 1210 8.0E-11
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 956 1303 4.0E-10
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 686 811 4.0E-10
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 984 1218 9.0E-10
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 207 642 2.0E-09
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 995 1218 1.0E-08
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 956 1303 2.0E-08
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 490 768 6.0E-08
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 490 738 6.0E-08
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 490 738 6.0E-08
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 499 738 2.0E-07
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 201 262 3.0E-07
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 490 735 6.0E-07
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 490 768 6.0E-07
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 1009 1290 7.0E-07
sp|P27972|GAG_SIVV1 Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag PE=3 SV=1 207 271 1.0E-06
sp|Q82850|GAG_JEMBR Gag polyprotein OS=Jembrana disease virus GN=gag PE=3 SV=1 150 280 1.0E-06
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 204 259 1.0E-06
sp|P05892|GAG_SIVVT Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag PE=3 SV=1 207 271 2.0E-06
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 980 1203 3.0E-06
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 202 257 3.0E-06
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 208 249 5.0E-06
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 207 252 5.0E-06
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 204 254 5.0E-06
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 207 249 5.0E-06
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 204 255 7.0E-06
sp|P19558|GAG_BIV29 Gag polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag PE=1 SV=2 202 251 7.0E-06
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 175 255 8.0E-06
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 204 252 8.0E-06
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 204 252 9.0E-06
sp|P27978|GAG_SIVVG Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag PE=3 SV=1 207 271 9.0E-06
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 150 251 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0015074 DNA integration Yes
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046872 metal ion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|725300
MSNDAAVTDFGGNREEFSEWWRSMTFFLKYNKVTDTDQKIIATIVRLKGPIPSYFAEVWTEKIASEITYTWDTFE
EEIKTSFGKGNEKDIAKEKIESLKQGKKNTMDFLVEFTALMYKAKTDNQHAIFLLKRHTRHDIIKTILGYPRKDI
PESREDWNNAILQVGTGLETMKRIDQRTETGTTFGGSGQRMEIGWKKFEWDKDGKPKCHKCGKFGHIGKNCKEKK
KSFGEKKNFKCFSCGKFGHIAKNCRSNRSGRIRAMNEDSDMKTTPRRSRVFPMVPRVQELEVKPLLTTTNGKKLK
LSAMVDSGCTHTCIDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNKQLDAVVTPLQSS
DLFLGHDWLTNHNPKIDWKQGIIKFNRCPASCSFPHSDISFEPGIRQLQSNEDTEEKEPDPTNPEDLPAYMKPFA
HLFNKKNFDKLPERTEWDHEINFTENAPTEISSKVYSMTPLEREELDKFLDENLATNRIRPSKSPYAAPCFFVPK
KDGSLRLCQDYRKLNDITIKDKTPLPLISEVLDQLKDAKVFNKLDIIWGYNNVRIREGDEWKAAFLTNRGLFEPT
VMFFGMSNSPATFSRMMATIFREMIQDGSLANYMDDFIIPAEDDEELEARTIRFLKIVEKHNLSFKRMKCEFNVS
STTVLGTVIGNGKATMEEEKVKAIRDWAVPTTVKQVESFLGFANFYRRFIKNFSTIAQPLNELKSKKGEKWYWND
EHQQAFEQIKQAIASEPVLALPKDKGKFRVEVDASNYGTGAVLSQEQENKWHPVAFMSKTLSEAERNYEIYDKEL
LAIIKALILWRHYLLDAKEQFEIWTDHENLKYFREPQKLNTRQARWYLMLQEYDFLLRHIPGKTNTKADILSRLI
IPDTSNDNRGVEMFKEKMFIRRLEESTPIYDVTFLHNRRFEILADETVLEKIRKCERRETRVLEEMKKQPEKVWE
NKGIIYRQGRIYVPDNQEIRDFILHDHHNSPDAGHPGTYRMLESVKRTFWWSTIKTDIRRYVRGCDMCQKNKTIR
RPDHIPLNPLPIPDKPWEEISIDMIGPLPKSKEKDAIIVIVDRFSKMIHLVPTTTSLTSTDLEEIYKEEVWRHHG
IPKRIISDRGPQFTSKFMESLCDALGIERNLSTAYHPQTERMNQEIETYLRAFINYRQDDWTRWLPMAEFHYNDK
THAATGQTPFFLNYGLHPWKGNITIETTNPTATSLIEELENVRKEAKAAMEANNEMMRERGNNKHHKEPFAEGDK
VWLETMNIHSNRPTRKLDHKRYGPFEILKQIGDRSYKLKLPDTCVRTLPECHGVTLSHLSHIILHNNFPLLLQFD
GG*
Coding >Agabi119p4|725300
ATGAGCAACGACGCCGCCGTAACCGATTTTGGAGGGAATAGAGAGGAGTTTTCAGAATGGTGGAGGAGCATGACA
TTTTTCCTCAAATACAACAAGGTCACGGACACTGACCAGAAAATTATCGCTACCATCGTACGATTGAAAGGACCA
ATTCCCAGTTATTTTGCCGAAGTATGGACAGAGAAAATCGCCAGCGAAATCACATACACGTGGGATACTTTTGAA
GAAGAAATCAAGACATCATTCGGAAAAGGAAACGAGAAGGATATAGCCAAAGAAAAGATCGAATCCCTCAAACAG
GGAAAGAAGAACACCATGGACTTCCTAGTCGAGTTCACAGCCCTCATGTACAAGGCCAAAACCGACAACCAACAC
GCCATATTCCTTCTCAAACGCCACACCCGTCACGATATTATCAAGACGATCTTAGGATATCCAAGGAAAGACATT
CCGGAGTCGAGAGAAGACTGGAATAACGCAATCTTACAAGTTGGGACAGGATTGGAGACGATGAAAAGGATTGAT
CAGAGGACCGAAACTGGAACCACTTTCGGAGGAAGCGGGCAACGAATGGAGATTGGATGGAAGAAATTCGAATGG
GACAAGGATGGAAAACCCAAATGTCACAAATGCGGAAAGTTCGGACACATCGGGAAGAACTGCAAAGAGAAGAAG
AAAAGTTTTGGAGAGAAGAAGAACTTCAAGTGTTTCAGTTGTGGGAAGTTTGGACACATTGCGAAAAATTGCCGA
AGCAACAGGAGTGGAAGGATTAGGGCGATGAACGAGGATTCCGACATGAAGACGACTCCAAGAAGGAGCAGGGTT
TTTCCGATGGTTCCGAGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACAACAAACGGAAAAAAACTCAAA
CTCTCAGCCATGGTCGACTCAGGATGCACACACACATGTATTGACGAAGAATTAGTGAAGAAGAAGAAAATTCCG
ACGAAGAAATTGGAACGACCGATCACATGCAGGAATTCAGATGGAACGATAGCAGGAAAGAAGGATATCACCAAA
TTCGTGAAAATGGATCTCAACATCAACGGTCATAACAAGCAACTGGATGCGGTCGTCACTCCCTTACAATCATCC
GACCTCTTTCTAGGCCATGATTGGTTAACGAACCACAACCCCAAGATTGATTGGAAACAAGGTATAATCAAATTC
AACCGGTGCCCCGCATCATGTTCTTTTCCCCATAGCGACATCTCTTTCGAACCAGGTATACGACAATTACAGTCT
AACGAAGACACTGAAGAAAAAGAACCGGATCCAACGAATCCTGAGGACTTACCAGCATACATGAAACCCTTCGCC
CATCTTTTCAACAAAAAGAACTTCGACAAACTCCCTGAACGGACAGAATGGGATCACGAAATCAACTTCACGGAA
AACGCACCTACGGAAATATCATCAAAGGTTTATAGCATGACACCATTGGAGAGAGAAGAACTGGACAAATTTTTG
GATGAAAACCTGGCCACCAATCGAATCCGACCATCAAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAG
AAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAACGACATCACGATCAAGGACAAGACACCACTA
CCCCTCATCAGCGAAGTATTAGATCAACTCAAAGATGCCAAGGTTTTCAACAAATTGGATATTATCTGGGGATAT
AACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAATCGAGGATTATTTGAACCAACG
GTCATGTTCTTCGGAATGAGTAATTCCCCTGCCACCTTTTCACGTATGATGGCGACAATCTTTCGTGAAATGATA
CAAGACGGATCCCTAGCCAACTACATGGACGATTTTATCATTCCAGCAGAAGACGATGAAGAATTAGAAGCACGA
ACTATACGTTTCCTCAAAATCGTGGAGAAACACAATCTATCATTCAAGCGGATGAAATGCGAGTTCAATGTCTCA
TCAACAACGGTGTTGGGAACAGTTATTGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGA
GATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGCTTTGCGAATTTCTATCGACGCTTTATC
AAGAATTTCAGCACCATCGCGCAACCACTAAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAACGAT
GAACATCAACAAGCTTTCGAACAAATAAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAA
GGAAAATTCAGAGTCGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAAACAAA
TGGCACCCGGTCGCTTTCATGTCGAAAACACTATCAGAAGCCGAAAGAAACTACGAAATCTACGACAAGGAACTA
CTAGCCATCATAAAAGCTTTGATATTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACA
GATCACGAGAACCTCAAGTATTTCCGAGAACCTCAAAAGCTCAACACTCGACAAGCGAGATGGTACCTCATGCTA
CAGGAATATGACTTCCTTCTACGACACATTCCTGGAAAAACTAACACCAAAGCAGACATCCTGTCAAGACTAATT
ATACCCGACACATCTAACGACAACCGAGGGGTAGAAATGTTCAAAGAGAAGATGTTCATCCGAAGGCTTGAAGAA
TCCACCCCCATCTATGATGTCACCTTCCTCCACAATCGAAGATTCGAAATTTTAGCCGATGAAACCGTACTTGAG
AAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAG
AACAAAGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCAC
GATCATCATAATTCCCCCGATGCCGGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGG
TGGTCCACGATCAAAACGGATATCAGAAGATATGTCAGAGGATGCGACATGTGCCAGAAGAACAAAACGATTCGA
CGACCCGATCACATTCCGCTTAACCCATTACCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATT
GGACCACTACCAAAGTCAAAGGAGAAGGATGCTATTATTGTTATCGTTGACAGATTCTCTAAAATGATCCACCTT
GTTCCCACCACCACGTCACTCACATCCACGGATCTAGAGGAAATCTACAAGGAAGAAGTTTGGCGACATCACGGA
ATTCCGAAGCGTATTATCAGTGACAGAGGACCACAATTCACATCAAAATTCATGGAATCATTATGCGATGCTCTA
GGGATCGAACGAAATCTTTCCACTGCCTATCACCCACAAACGGAGAGGATGAACCAGGAAATTGAGACTTATCTT
CGAGCATTCATCAATTATCGACAAGACGATTGGACGAGATGGCTTCCCATGGCAGAATTCCATTACAACGACAAA
ACCCACGCTGCCACCGGACAAACCCCATTCTTCCTGAATTACGGACTTCACCCATGGAAGGGTAATATCACGATT
GAAACGACGAACCCCACTGCCACCTCCTTGATCGAAGAATTAGAGAATGTACGGAAAGAAGCTAAAGCTGCGATG
GAAGCAAACAACGAGATGATGAGAGAAAGAGGAAACAACAAGCACCACAAGGAACCCTTTGCCGAAGGAGATAAA
GTTTGGTTGGAAACGATGAACATTCATTCCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCTTTC
GAGATCTTGAAACAAATCGGCGATCGATCTTACAAACTGAAGTTACCTGATACCTGTGTTAGAACTTTGCCAGAA
TGTCACGGCGTCACGCTGTCACATCTGTCACATATTATATTACATAATAATTTCCCTCTGCTGCTACAGTTCGAC
GGAGGCTAA
Transcript >Agabi119p4|725300
ATGAGCAACGACGCCGCCGTAACCGATTTTGGAGGGAATAGAGAGGAGTTTTCAGAATGGTGGAGGAGCATGACA
TTTTTCCTCAAATACAACAAGGTCACGGACACTGACCAGAAAATTATCGCTACCATCGTACGATTGAAAGGACCA
ATTCCCAGTTATTTTGCCGAAGTATGGACAGAGAAAATCGCCAGCGAAATCACATACACGTGGGATACTTTTGAA
GAAGAAATCAAGACATCATTCGGAAAAGGAAACGAGAAGGATATAGCCAAAGAAAAGATCGAATCCCTCAAACAG
GGAAAGAAGAACACCATGGACTTCCTAGTCGAGTTCACAGCCCTCATGTACAAGGCCAAAACCGACAACCAACAC
GCCATATTCCTTCTCAAACGCCACACCCGTCACGATATTATCAAGACGATCTTAGGATATCCAAGGAAAGACATT
CCGGAGTCGAGAGAAGACTGGAATAACGCAATCTTACAAGTTGGGACAGGATTGGAGACGATGAAAAGGATTGAT
CAGAGGACCGAAACTGGAACCACTTTCGGAGGAAGCGGGCAACGAATGGAGATTGGATGGAAGAAATTCGAATGG
GACAAGGATGGAAAACCCAAATGTCACAAATGCGGAAAGTTCGGACACATCGGGAAGAACTGCAAAGAGAAGAAG
AAAAGTTTTGGAGAGAAGAAGAACTTCAAGTGTTTCAGTTGTGGGAAGTTTGGACACATTGCGAAAAATTGCCGA
AGCAACAGGAGTGGAAGGATTAGGGCGATGAACGAGGATTCCGACATGAAGACGACTCCAAGAAGGAGCAGGGTT
TTTCCGATGGTTCCGAGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACAACAAACGGAAAAAAACTCAAA
CTCTCAGCCATGGTCGACTCAGGATGCACACACACATGTATTGACGAAGAATTAGTGAAGAAGAAGAAAATTCCG
ACGAAGAAATTGGAACGACCGATCACATGCAGGAATTCAGATGGAACGATAGCAGGAAAGAAGGATATCACCAAA
TTCGTGAAAATGGATCTCAACATCAACGGTCATAACAAGCAACTGGATGCGGTCGTCACTCCCTTACAATCATCC
GACCTCTTTCTAGGCCATGATTGGTTAACGAACCACAACCCCAAGATTGATTGGAAACAAGGTATAATCAAATTC
AACCGGTGCCCCGCATCATGTTCTTTTCCCCATAGCGACATCTCTTTCGAACCAGGTATACGACAATTACAGTCT
AACGAAGACACTGAAGAAAAAGAACCGGATCCAACGAATCCTGAGGACTTACCAGCATACATGAAACCCTTCGCC
CATCTTTTCAACAAAAAGAACTTCGACAAACTCCCTGAACGGACAGAATGGGATCACGAAATCAACTTCACGGAA
AACGCACCTACGGAAATATCATCAAAGGTTTATAGCATGACACCATTGGAGAGAGAAGAACTGGACAAATTTTTG
GATGAAAACCTGGCCACCAATCGAATCCGACCATCAAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAG
AAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAACGACATCACGATCAAGGACAAGACACCACTA
CCCCTCATCAGCGAAGTATTAGATCAACTCAAAGATGCCAAGGTTTTCAACAAATTGGATATTATCTGGGGATAT
AACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAATCGAGGATTATTTGAACCAACG
GTCATGTTCTTCGGAATGAGTAATTCCCCTGCCACCTTTTCACGTATGATGGCGACAATCTTTCGTGAAATGATA
CAAGACGGATCCCTAGCCAACTACATGGACGATTTTATCATTCCAGCAGAAGACGATGAAGAATTAGAAGCACGA
ACTATACGTTTCCTCAAAATCGTGGAGAAACACAATCTATCATTCAAGCGGATGAAATGCGAGTTCAATGTCTCA
TCAACAACGGTGTTGGGAACAGTTATTGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGA
GATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGCTTTGCGAATTTCTATCGACGCTTTATC
AAGAATTTCAGCACCATCGCGCAACCACTAAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAACGAT
GAACATCAACAAGCTTTCGAACAAATAAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAA
GGAAAATTCAGAGTCGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAAACAAA
TGGCACCCGGTCGCTTTCATGTCGAAAACACTATCAGAAGCCGAAAGAAACTACGAAATCTACGACAAGGAACTA
CTAGCCATCATAAAAGCTTTGATATTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACA
GATCACGAGAACCTCAAGTATTTCCGAGAACCTCAAAAGCTCAACACTCGACAAGCGAGATGGTACCTCATGCTA
CAGGAATATGACTTCCTTCTACGACACATTCCTGGAAAAACTAACACCAAAGCAGACATCCTGTCAAGACTAATT
ATACCCGACACATCTAACGACAACCGAGGGGTAGAAATGTTCAAAGAGAAGATGTTCATCCGAAGGCTTGAAGAA
TCCACCCCCATCTATGATGTCACCTTCCTCCACAATCGAAGATTCGAAATTTTAGCCGATGAAACCGTACTTGAG
AAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAG
AACAAAGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCAC
GATCATCATAATTCCCCCGATGCCGGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGG
TGGTCCACGATCAAAACGGATATCAGAAGATATGTCAGAGGATGCGACATGTGCCAGAAGAACAAAACGATTCGA
CGACCCGATCACATTCCGCTTAACCCATTACCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATT
GGACCACTACCAAAGTCAAAGGAGAAGGATGCTATTATTGTTATCGTTGACAGATTCTCTAAAATGATCCACCTT
GTTCCCACCACCACGTCACTCACATCCACGGATCTAGAGGAAATCTACAAGGAAGAAGTTTGGCGACATCACGGA
ATTCCGAAGCGTATTATCAGTGACAGAGGACCACAATTCACATCAAAATTCATGGAATCATTATGCGATGCTCTA
GGGATCGAACGAAATCTTTCCACTGCCTATCACCCACAAACGGAGAGGATGAACCAGGAAATTGAGACTTATCTT
CGAGCATTCATCAATTATCGACAAGACGATTGGACGAGATGGCTTCCCATGGCAGAATTCCATTACAACGACAAA
ACCCACGCTGCCACCGGACAAACCCCATTCTTCCTGAATTACGGACTTCACCCATGGAAGGGTAATATCACGATT
GAAACGACGAACCCCACTGCCACCTCCTTGATCGAAGAATTAGAGAATGTACGGAAAGAAGCTAAAGCTGCGATG
GAAGCAAACAACGAGATGATGAGAGAAAGAGGAAACAACAAGCACCACAAGGAACCCTTTGCCGAAGGAGATAAA
GTTTGGTTGGAAACGATGAACATTCATTCCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCTTTC
GAGATCTTGAAACAAATCGGCGATCGATCTTACAAACTGAAGTTACCTGATACCTGTGTTAGAACTTTGCCAGAA
TGTCACGGCGTCACGCTGTCACATCTGTCACATATTATATTACATAATAATTTCCCTCTGCTGCTACAGTTCGAC
GGAGGCTAA
Gene >Agabi119p4|725300
ATGAGCAACGACGCCGCCGTAACCGTTAGTGCACAGGACAGATGTACTCAAGTCACTCATCCCGAACCCGAAGGA
TTTTGGAGGGAATAGAGAGGAGTTTTCAGAATGGTGGAGGAGCATGACATTTTTCCTCAAATACAACAAGGTCAC
GGACACTGACCAGAAAATTATCGCTACCATCGTACGATTGAAAGGACCAATTCCCAGTTATTTTGCCGAAGTATG
GACAGAGAAAATCGCCAGCGAAATCACATACACGTGGGATACTTTTGAAGAAGAAATCAAGACATCATTCGGAAA
AGGAAACGAGAAGGATATAGCCAAAGAAAAGATCGAATCCCTCAAACAGGGAAAGAAGAACACCATGGACTTCCT
AGTCGAGTTCACAGCCCTCATGTACAAGGCCAAAACCGACAACCAACACGCCATATTCCTTCTCAAACGCCACAC
CCGTCACGATATTATCAAGACGATCTTAGGATATCCAAGGAAAGACATTCCGGAGTCGAGAGAAGACTGGAATAA
CGCAATCTTACAAGTTGGGACAGGATTGGAGACGATGAAAAGGATTGATCAGAGGACCGAAACTGGAACCACTTT
CGGAGGAAGCGGGCAACGAATGGAGATTGGATGGAAGAAATTCGAATGGGACAAGGATGGAAAACCCAAATGTCA
CAAATGCGGAAAGTTCGGACACATCGGGAAGAACTGCAAAGAGAAGAAGAAAAGTTTTGGAGAGAAGAAGAACTT
CAAGTGTTTCAGTTGTGGGAAGTTTGGACACATTGCGAAAAATTGCCGAAGCAACAGGAGTGGAAGGATTAGGGC
GATGAACGAGGATTCCGACATGAAGACGACTCCAAGAAGGAGCAGGGTTTTTCCGATGGTTCCGAGTAGGCACGA
CCTCGCGAACCAATGTACCTAGACGAATGAACAATCGATATGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAAC
TGGAAGTAAAACCCCTCCTCACTACAACAAACGGAAAAAAACTCAAACTCTCAGCCATGGTCGACTCAGGATGCA
CACACACATGTATTGACGAAGAATTAGTGAAGAAGAAGAAAATTCCGACGAAGAAATTGGAACGACCGATCACAT
GCAGGAATTCAGATGGAACGATAGCAGGAAAGAAGGATATCACCAAATTCGTGAAAATGGATCTCAACATCAACG
GTCATAACAAGCAACTGGATGCGGTCGTCACTCCCTTACAATCATCCGACCTCTTTCTAGGCCATGATTGGTTAA
CGAACCACAACCCCAAGATTGATTGGAAACAAGGTATAATCAAATTCAACCGGTGCCCCGCATCATGTTCTTTTC
CCCATAGCGACATCTCTTTCGAACCAGGTATACGACAATTACAGTCTAACGAAGACACTGAAGAAAAAGAACCGG
ATCCAACGAATCCTGAGGACTTACCAGCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAAGAACTTCGACA
AACTCCCTGAACGGACAGAATGGGATCACGAAATCAACTTCACGGAAAACGCACCTACGGAAATATCATCAAAGG
TTTATAGCATGACACCATTGGAGAGAGAAGAACTGGACAAATTTTTGGATGAAAACCTGGCCACCAATCGAATCC
GACCATCAAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGG
ATTATAGGAAACTGAACGACATCACGATCAAGGACAAGACACCACTACCCCTCATCAGCGAAGTATTAGATCAAC
TCAAAGATGCCAAGGTTTTCAACAAATTGGATATTATCTGGGGATATAACAACGTTCGGATACGAGAAGGAGATG
AATGGAAAGCAGCGTTCTTGACGAATCGAGGATTATTTGAACCAACGGTCATGTTCTTCGGAATGAGTAATTCCC
CTGCCACCTTTTCACGTATGATGGCGACAATCTTTCGTGAAATGATACAAGACGGATCCCTAGCCAACTACATGG
ACGATTTTATCATTCCAGCAGAAGACGATGAAGAATTAGAAGCACGAACTATACGTTTCCTCAAAATCGTGGAGA
AACACAATCTATCATTCAAGCGGATGAAATGCGAGTTCAATGTCTCATCAACAACGGTGTTGGGAACAGTTATTG
GGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCACGGTCAAAC
AAGTCGAAAGCTTTTTAGGCTTTGCGAATTTCTATCGACGCTTTATCAAGAATTTCAGCACCATCGCGCAACCAC
TAAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAACGATGAACATCAACAAGCTTTCGAACAAATAA
AACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAAGGAAAATTCAGAGTCGAAGTAGACGCAT
CAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAAACAAATGGCACCCGGTCGCTTTCATGTCGAAAA
CACTATCAGAAGCCGAAAGAAACTACGAAATCTACGACAAGGAACTACTAGCCATCATAAAAGCTTTGATATTAT
GGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACAGATCACGAGAACCTCAAGTATTTCCGAG
AACCTCAAAAGCTCAACACTCGACAAGCGAGATGGTACCTCATGCTACAGGAATATGACTTCCTTCTACGACACA
TTCCTGGAAAAACTAACACCAAAGCAGACATCCTGTCAAGACTAATTATACCCGACACATCTAACGACAACCGAG
GGGTAGAAATGTTCAAAGAGAAGATGTTCATCCGAAGGCTTGAAGAATCCACCCCCATCTATGATGTCACCTTCC
TCCACAATCGAAGATTCGAAATTTTAGCCGATGAAACCGTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAA
CCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAGAACAAAGGAATCATTTACCGACAAGGAA
GGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCACGATCATCATAATTCCCCCGATGCCGGAC
ATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGGTGGTCCACGATCAAAACGGATATCAGAA
GATATGTCAGAGGATGCGACATGTGCCAGAAGAACAAAACGATTCGACGACCCGATCACATTCCGCTTAACCCAT
TACCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATTGGACCACTACCAAAGTCAAAGGAGAAGG
ATGCTATTATTGTTATCGTTGACAGATTCTCTAAAATGATCCACCTTGTTCCCACCACCACGTCACTCACATCCA
CGGATCTAGAGGAAATCTACAAGGAAGAAGTTTGGCGACATCACGGAATTCCGAAGCGTATTATCAGTGACAGAG
GACCACAATTCACATCAAAATTCATGGAATCATTATGCGATGCTCTAGGGATCGAACGAAATCTTTCCACTGCCT
ATCACCCACAAACGGAGAGGATGAACCAGGAAATTGAGACTTATCTTCGAGCATTCATCAATTATCGACAAGACG
ATTGGACGAGATGGCTTCCCATGGCAGAATTCCATTACAACGACAAAACCCACGCTGCCACCGGACAAACCCCAT
TCTTCCTGAATTACGGACTTCACCCATGGAAGGGTAATATCACGATTGAAACGACGAACCCCACTGCCACCTCCT
TGATCGAAGAATTAGAGAATGTACGGAAAGAAGCTAAAGCTGCGATGGAAGCAAACAACGAGATGATGAGAGAAA
GAGGAAACAACAAGCACCACAAGGAACCCTTTGCCGAAGGAGATAAAGTTTGGTTGGAAACGATGAACATTCATT
CCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCTTTCGAGATCTTGAAACAAATCGGCGATCGAT
CTTACAAACTGAAGTTACCTGATACCTGTGTTAGAACTTTGCCAGAATGTCACGGCGTCACGCTGTCACATCTGT
CACATATTATATTACATAATAATTTCCCTCTGCTGCTACAGTTCGACGGAGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail