Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|718100
Gene name
Locationscaffold_09:1325912..1326869
Strand+
Gene length (bp)957
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 2.2E-09 14 128

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 14 316 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|718100
MVEQEQRIHFQGIQDSPVKMWEALEAVHRQKRAGMCFNAYDDLFSIRKLEEESLQSLINRVESSKQKIKELRPSS
FTLEQLDDELASMALIRALPDEFSGFTSSLLLMDKLDKTTVHQAFVTEDLQRRKRAQDASGSSQALAARSGSQFA
TKTCDFCGREGHKFAECKTFERAKSRAQEDAQKPRTPYKRANKAQEESGSSSSTQTPEKVQRVTEFAGNASTPYP
SPSPLPSTPLQLDADFHWLADTGATSHMTPHRHWFKSYTSHKIPIRLADNSIVYSSGVGSVVFEPVVNGKVVRAV
ELTRVLHVPALRSNLLLE*
Coding >Agabi119p4|718100
ATGGTGGAGCAGGAGCAGAGAATTCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGGGAGGCTCTAGAG
GCTGTACATCGACAGAAAAGGGCTGGAATGTGTTTCAATGCCTATGATGACCTCTTCTCCATTCGAAAACTCGAG
GAGGAGTCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACAAAAAATCAAGGAGCTCAGACCCTCTTCC
TTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGACGAGTTTTCCGGC
TTTACTTCGTCCTTATTGCTTATGGACAAGCTGGACAAGACTACAGTCCATCAGGCCTTTGTCACTGAGGACTTA
CAACGTCGAAAACGCGCTCAGGACGCCTCTGGGAGCTCTCAGGCTCTTGCAGCTCGCTCTGGCTCCCAATTTGCG
ACGAAAACCTGCGACTTCTGCGGGAGAGAGGGCCACAAGTTCGCTGAATGCAAAACCTTCGAGAGAGCGAAGTCC
CGGGCACAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCTGGGAGC
TCTAGCTCGACTCAGACTCCCGAAAAAGTGCAGAGAGTCACTGAGTTTGCTGGCAATGCAAGTACTCCTTATCCC
TCACCTTCTCCCTTGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACT
TCTCATATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAAC
TCTATTGTCTATTCTTCGGGGGTGGGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTC
GAGTTGACTAGAGTTTTGCATGTCCCGGCTCTCCGGAGCAATCTACTGTTAGAGTGA
Transcript >Agabi119p4|718100
ATGGTGGAGCAGGAGCAGAGAATTCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGGGAGGCTCTAGAG
GCTGTACATCGACAGAAAAGGGCTGGAATGTGTTTCAATGCCTATGATGACCTCTTCTCCATTCGAAAACTCGAG
GAGGAGTCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACAAAAAATCAAGGAGCTCAGACCCTCTTCC
TTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGACGAGTTTTCCGGC
TTTACTTCGTCCTTATTGCTTATGGACAAGCTGGACAAGACTACAGTCCATCAGGCCTTTGTCACTGAGGACTTA
CAACGTCGAAAACGCGCTCAGGACGCCTCTGGGAGCTCTCAGGCTCTTGCAGCTCGCTCTGGCTCCCAATTTGCG
ACGAAAACCTGCGACTTCTGCGGGAGAGAGGGCCACAAGTTCGCTGAATGCAAAACCTTCGAGAGAGCGAAGTCC
CGGGCACAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCTGGGAGC
TCTAGCTCGACTCAGACTCCCGAAAAAGTGCAGAGAGTCACTGAGTTTGCTGGCAATGCAAGTACTCCTTATCCC
TCACCTTCTCCCTTGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACT
TCTCATATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAAC
TCTATTGTCTATTCTTCGGGGGTGGGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTC
GAGTTGACTAGAGTTTTGCATGTCCCGGCTCTCCGGAGCAATCTACTGTTAGAGTGA
Gene >Agabi119p4|718100
ATGGTGGAGCAGGAGCAGAGAATTCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGGGAGGCTCTAGAG
GCTGTACATCGACAGAAAAGGGCTGGAATGTGTTTCAATGCCTATGATGACCTCTTCTCCATTCGAAAACTCGAG
GAGGAGTCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACAAAAAATCAAGGAGCTCAGACCCTCTTCC
TTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGACGAGTTTTCCGGC
TTTACTTCGTCCTTATTGCTTATGGACAAGCTGGACAAGACTACAGTCCATCAGGCCTTTGTCACTGAGGACTTA
CAACGTCGAAAACGCGCTCAGGACGCCTCTGGGAGCTCTCAGGCTCTTGCAGCTCGCTCTGGCTCCCAATTTGCG
ACGAAAACCTGCGACTTCTGCGGGAGAGAGGGCCACAAGTTCGCTGAATGCAAAACCTTCGAGAGAGCGAAGTCC
CGGGCACAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCTGGGAGC
TCTAGCTCGACTCAGACTCCCGAAAAAGTGCAGAGAGTCACTGAGTTTGCTGGCAATGCAAGTACTCCTTATCCC
TCACCTTCTCCCTTGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACT
TCTCATATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAAC
TCTATTGTCTATTCTTCGGGGGTGGGATCTGTAGTCTTTGAGCCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTC
GAGTTGACTAGAGTTTTGCATGTCCCGGCTCTCCGGAGCAATCTACTGTTAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail