Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|715950
Gene name
Locationscaffold_09:1190852..1193140
Strand-
Gene length (bp)2288
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14737 DUF4470 Domain of unknown function (DUF4470) 3.3E-11 147 205
PF01753 zf-MYND MYND finger 1.1E-07 68 102

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|715950
MMNDELMGRFYRAMQAESQEREIPCQRDIFDGCPEASYLIDYARRKDAPIYAVKRLLCANVNVEKSEDCKKSGTF
ICTKCRLVSYCSKECQTVHWSAHKQDCKDRLLSKDWRPCWAVEGRSPSFLDKGPESQFERWDTEELSMGPNLWGN
MAAMDIVNLPNNEADSTKDLTLAFIASGDLRNVVRTIALPSDYSGKLKILMNDKLSYLLILPFISDDSEGLSFPL
GPRSTLLVGMPPESIKAAFANWSTCLSTTETRAEYHRMRKAPSRRDFYDRMYANLRPSHRVAFQGFRRSGVVLPF
GASHAHFDIPNATLFSGNGKWLQRDYADPLSGWNPDEVIKAGKAHGAQAEDIYGCLYFFLLDELSSFARRLRQLR
ITFNIYNLTASDLSLAIRHNSFWSEGIPASIRFDRIEVSNILDVNYIGIRGVVSNWASLLSKSSSATILGYFMNW
TMLQEDGDMSTGKDLRAVQRVARVWAAKMKAEGRQGDPVQLLLTSLPDLNALNDNSGPFMRYLNKQGLDGILQST
KLKLRKTHTIVPHRNRAPLSGSLNALPEFPDRDSWYYHVRVIFAYSSAF*
Coding >Agabi119p4|715950
ATGATGAATGACGAGCTCATGGGTCGATTTTATAGGGCCATGCAGGCTGAATCTCAAGAACGCGAAATCCCATGT
CAGCGCGATATTTTCGACGGATGTCCCGAAGCCTCCTACCTCATAGATTATGCAAGAAGAAAGGACGCCCCAATT
TACGCCGTCAAACGGTTGCTCTGTGCTAACGTGAATGTTGAAAAGAGCGAGGACTGCAAGAAGTCGGGTACTTTC
ATATGCACCAAATGCAGACTCGTCTCATACTGCTCGAAAGAGTGTCAAACGGTTCACTGGTCCGCTCATAAGCAA
GATTGCAAGGATCGTCTCTTGTCTAAGGACTGGCGTCCTTGTTGGGCTGTCGAAGGTCGTTCCCCATCTTTCCTC
GACAAGGGTCCTGAATCCCAATTTGAACGATGGGACACGGAAGAACTCTCCATGGGCCCGAATCTGTGGGGAAAT
ATGGCCGCCATGGACATTGTTAATCTGCCTAACAATGAGGCAGATTCGACCAAGGATTTGACGTTGGCCTTTATC
GCATCTGGTGATCTTCGAAATGTCGTGCGGACGATCGCTTTACCTTCTGATTACTCGGGAAAATTGAAAATCCTG
ATGAACGACAAATTATCTTACCTGCTGATATTGCCCTTCATTTCTGATGACTCAGAAGGTCTCTCTTTTCCTCTG
GGTCCTCGCTCGACATTGTTAGTTGGCATGCCTCCAGAATCCATCAAAGCTGCGTTTGCGAATTGGTCAACATGT
CTCTCAACCACGGAGACAAGAGCCGAATATCATCGTATGAGGAAGGCTCCATCGCGCCGTGATTTCTATGACAGA
ATGTATGCAAACTTGAGACCATCGCATCGTGTTGCCTTTCAGGGGTTTCGTCGCTCCGGCGTTGTCCTTCCATTT
GGCGCGTCCCATGCCCATTTTGATATCCCCAACGCCACTCTTTTCTCGGGCAACGGCAAATGGTTACAAAGGGAT
TATGCGGATCCACTCAGTGGTTGGAATCCCGATGAAGTCATTAAAGCAGGTAAAGCACACGGTGCTCAAGCTGAG
GATATATATGGTTGTCTTTATTTCTTCCTGTTAGACGAACTGAGCAGCTTTGCCCGCCGGCTACGACAACTTCGG
ATCACCTTCAATATCTATAACCTTACCGCTTCCGATCTCTCTCTTGCTATCCGTCACAACTCATTTTGGTCAGAG
GGTATTCCTGCCTCGATTCGATTTGACCGTATCGAAGTGTCAAATATTCTCGACGTCAACTACATTGGTATACGT
GGTGTTGTATCAAACTGGGCTTCTTTACTCTCAAAAAGTTCCTCTGCCACTATTCTCGGTTATTTCATGAATTGG
ACTATGCTGCAGGAGGATGGCGATATGTCAACAGGAAAGGACCTACGTGCCGTGCAACGCGTTGCGCGCGTTTGG
GCAGCCAAGATGAAGGCAGAAGGTCGTCAGGGAGATCCTGTCCAACTGCTATTAACATCACTACCTGACCTGAAC
GCCCTTAACGACAATTCCGGCCCTTTCATGAGATATTTGAATAAACAGGGATTAGATGGTATCCTCCAGAGTACA
AAACTCAAGTTAAGGAAAACGCACACCATTGTTCCTCATCGCAATCGGGCACCCTTGTCTGGGTCATTGAATGCA
TTGCCAGAGTTTCCTGATAGAGACAGTTGGTATTACCATGTACGTGTCATCTTTGCCTACAGCAGCGCCTTTTAA
Transcript >Agabi119p4|715950
ATGATGAATGACGAGCTCATGGGTCGATTTTATAGGGCCATGCAGGCTGAATCTCAAGAACGCGAAATCCCATGT
CAGCGCGATATTTTCGACGGATGTCCCGAAGCCTCCTACCTCATAGATTATGCAAGAAGAAAGGACGCCCCAATT
TACGCCGTCAAACGGTTGCTCTGTGCTAACGTGAATGTTGAAAAGAGCGAGGACTGCAAGAAGTCGGGTACTTTC
ATATGCACCAAATGCAGACTCGTCTCATACTGCTCGAAAGAGTGTCAAACGGTTCACTGGTCCGCTCATAAGCAA
GATTGCAAGGATCGTCTCTTGTCTAAGGACTGGCGTCCTTGTTGGGCTGTCGAAGGTCGTTCCCCATCTTTCCTC
GACAAGGGTCCTGAATCCCAATTTGAACGATGGGACACGGAAGAACTCTCCATGGGCCCGAATCTGTGGGGAAAT
ATGGCCGCCATGGACATTGTTAATCTGCCTAACAATGAGGCAGATTCGACCAAGGATTTGACGTTGGCCTTTATC
GCATCTGGTGATCTTCGAAATGTCGTGCGGACGATCGCTTTACCTTCTGATTACTCGGGAAAATTGAAAATCCTG
ATGAACGACAAATTATCTTACCTGCTGATATTGCCCTTCATTTCTGATGACTCAGAAGGTCTCTCTTTTCCTCTG
GGTCCTCGCTCGACATTGTTAGTTGGCATGCCTCCAGAATCCATCAAAGCTGCGTTTGCGAATTGGTCAACATGT
CTCTCAACCACGGAGACAAGAGCCGAATATCATCGTATGAGGAAGGCTCCATCGCGCCGTGATTTCTATGACAGA
ATGTATGCAAACTTGAGACCATCGCATCGTGTTGCCTTTCAGGGGTTTCGTCGCTCCGGCGTTGTCCTTCCATTT
GGCGCGTCCCATGCCCATTTTGATATCCCCAACGCCACTCTTTTCTCGGGCAACGGCAAATGGTTACAAAGGGAT
TATGCGGATCCACTCAGTGGTTGGAATCCCGATGAAGTCATTAAAGCAGGTAAAGCACACGGTGCTCAAGCTGAG
GATATATATGGTTGTCTTTATTTCTTCCTGTTAGACGAACTGAGCAGCTTTGCCCGCCGGCTACGACAACTTCGG
ATCACCTTCAATATCTATAACCTTACCGCTTCCGATCTCTCTCTTGCTATCCGTCACAACTCATTTTGGTCAGAG
GGTATTCCTGCCTCGATTCGATTTGACCGTATCGAAGTGTCAAATATTCTCGACGTCAACTACATTGGTATACGT
GGTGTTGTATCAAACTGGGCTTCTTTACTCTCAAAAAGTTCCTCTGCCACTATTCTCGGTTATTTCATGAATTGG
ACTATGCTGCAGGAGGATGGCGATATGTCAACAGGAAAGGACCTACGTGCCGTGCAACGCGTTGCGCGCGTTTGG
GCAGCCAAGATGAAGGCAGAAGGTCGTCAGGGAGATCCTGTCCAACTGCTATTAACATCACTACCTGACCTGAAC
GCCCTTAACGACAATTCCGGCCCTTTCATGAGATATTTGAATAAACAGGGATTAGATGGTATCCTCCAGAGTACA
AAACTCAAGTTAAGGAAAACGCACACCATTGTTCCTCATCGCAATCGGGCACCCTTGTCTGGGTCATTGAATGCA
TTGCCAGAGTTTCCTGATAGAGACAGTTGGTATTACCATGTACGTGTCATCTTTGCCTACAGCAGCGCCTTTTAA
Gene >Agabi119p4|715950
ATGATGAATGACGAGCTCATGGGTCGATTTTATAGGGCCATGCAGGCTGAATCTCAAGAACGCGAAATCCCATGT
CAGCGCGATATTTTCGACGGATGTCCCGAAGCCTCCTACCTCATAGATTATGCAAGAAGAAAGGACGCCCCAATT
TACGCCGTCAAACGGTTGCTCTGTGCTAACGTGAATGTTGAAAAGAGCGAGGACTGCAAGAAGTCGGGTACTTTC
ATATGCACCAAATGCAGACTCGTCTCATACTGCTCGAAAGTAAGCCTTCTCAGTATCCCTCCGATCAAGGTTTTT
CAGCTTCATTCAGGAGTGTCAAACGGTTCACTGGTCCGCTCATAAGCAAGGTACCCCTTTATTTGTATCCATTAC
GAAAACCCCCTTATATTGTTCTTCAGATTGCAAGGATCGTCTCTTGTCTAAGGACTGGCGTCCTTGTTGGGCTGT
CGAAGGTCGTTCCCCATCTTTCCTCGACAAGGGTCCTGAATCCCAATTTGAACGATGGGACACGGAAGAACTCTC
CATGGGCCCGAATCTGTAAGACTACTCGTACATTTTGAATGTCTTCAGATGATAAGATGTCAGGTGGGGAAATAT
GGCCGCCATGGACATTGTTAATCTGCCTAACAATGAGGCAGATTCGACCAAGGATTTGACGTTGGCCTTTATCGG
TATGTGGTTCTTCTTAATTCTCTAAACATGTTTTTACAATCAAAACAACCTCAGCATCTGGTGATCTTCGAAATG
TCGTGCGGACGATCGCTTTACCTTCTGATTACTCGGGAAAATTGAAAATCCTGATGAACGACAAATTATCTTACG
TTAGCTGTCGAAACATGGTTCTACTCTCCCTGTTGGGAACCATTTCCGATGAACTTCTAGCTGCTGATATTGCCC
TTCATTTCTGGTATTCGGCATATTTGCCATATGAATACCGTATGAAAGTCACCGGAAAGATTATGGAGATTCTGA
GATGGAAGGCGGCAGATGACTCAGAAGGTCTCTCTTTTCCTCTGGGTCCTCGCTCGACATTGTTAGTTGGCATGC
CTCCAGAATCCATCAAAGCTGCGTTTGCGAATTGGTCAACATGTCTCTCAACCACGGAGACAAGAGCCGAATATC
ATCGTATGAGGAAGGCTCCATCGCGCCGTGATTTCTATGACAGAATGTATGCAAACTTGAGACCATCGCATCGTG
TTGCCTTTCAGGGGTTTCGTCGCTCCGGCGTTGTCCTTCCATTTGGCGCGTCCCATGCCCATTTTGATATCCCCA
ACGCCACTCTTTTCTCGGGCAACGGCAAATGGTTACAAAGGGATTATGCGGATCCACTCAGTGGTTGGAAGTAAG
TTGTCATATACTGTTATGATTTCATGAGGTTTTTGACCATTTTGAAAGTCCCGATGAAGTCATTAAAGCAGGTAA
AGCACACGGTGCTCAAGCTGAGGATATATATGGTTGTCTTTATTTCTTCCTGTTAGACGAACTGAGCAGCTTTGC
CCGCCGGCTACGACAACTTCGGATCACCTTCAATATCTATAACCTTACCGCTTCCGATCTCTCTCTTGCTATCCG
TCACAACTCATTTTGGTCAGAGGGTATTCCTGCCTCGATTCGATTTGACCGTATCGAAGTGTCAAATATTCTCGA
CGTCAACTACATTGGTATACGTGGTGTTGTATCAAACTGGGCTTCTTTACTCTCAAAAAGTTCCTCTGCCACTAT
TCTCGGTTATTTCATGAATTGGACTATGCTGCAGGAGGATGGCGATATGTCAACAGGAAAGGACCTACGTGCCGT
GCAACGCGTTGCGCGCGTTTGGGCAGCCAAGATGAAGGTGAGGATATAGCGTTAGAATGTTCTCAGTAAACATTT
TATAAAAGACGTCACTCTAGGCAGAAGGTCGTCAGGGAGATCCTGGTATGAAAGCCGTCTTTCATGTCAAGTCTC
GGACTTTTTCTTACTCCAGCTGCAGTCCAACTGCTATTAACATCACTACCTGACCTGAACGCCCTTAACGACAAT
TCCGGCCCTTTCATGAGATATTTGAATAAACAGGGATTAGATGGTATCCTCCAGAGTACAAAACTCAAGTTAAGG
AAAACGCACACCATTGTTCCTCATGTGAGTCGACATGCATTCAATATCCCTGGCGCTAAATGTTGATATACCCTA
AGCGCAATCGGGCACCCTTGTCTGGGTCATTGAATGCATTGCCAGAGTTTCCTGATAGAGACAGTTGGTATTACC
ATGTACGTGTCATCTTTGCCTACAGCAGCGCCTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail