Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|715700
Gene name
Locationscaffold_09:1156837..1158158
Strand+
Gene length (bp)1321
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01048 PNP_UDP_1 Phosphorylase superfamily 5.0E-40 68 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTG1|PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1805.16c PE=3 SV=1 32 347 6.0E-76
sp|P55859|PNPH_BOVIN Purine nucleoside phosphorylase OS=Bos taurus GN=PNP PE=1 SV=3 65 340 1.0E-69
sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens GN=PNP PE=1 SV=2 51 340 2.0E-69
sp|P85973|PNPH_RAT Purine nucleoside phosphorylase OS=Rattus norvegicus GN=Pnp PE=1 SV=1 52 345 1.0E-68
sp|Q05788|PNPH_YEAST Purine nucleoside phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNP1 PE=1 SV=1 49 344 2.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTG1|PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1805.16c PE=3 SV=1 32 347 6.0E-76
sp|P55859|PNPH_BOVIN Purine nucleoside phosphorylase OS=Bos taurus GN=PNP PE=1 SV=3 65 340 1.0E-69
sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens GN=PNP PE=1 SV=2 51 340 2.0E-69
sp|P85973|PNPH_RAT Purine nucleoside phosphorylase OS=Rattus norvegicus GN=Pnp PE=1 SV=1 52 345 1.0E-68
sp|Q05788|PNPH_YEAST Purine nucleoside phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNP1 PE=1 SV=1 49 344 2.0E-68
sp|P23492|PNPH_MOUSE Purine nucleoside phosphorylase OS=Mus musculus GN=Pnp PE=1 SV=2 66 345 2.0E-68
sp|P46354|PUNA_BACSU Purine nucleoside phosphorylase 1 OS=Bacillus subtilis (strain 168) GN=punA PE=1 SV=1 45 309 2.0E-60
sp|P77834|PUNA_GEOSE Purine nucleoside phosphorylase 1 OS=Geobacillus stearothermophilus GN=punA PE=1 SV=1 46 289 7.0E-57
sp|P45563|XAPA_ECOLI Purine nucleoside phosphorylase 2 OS=Escherichia coli (strain K12) GN=xapA PE=1 SV=2 48 314 6.0E-47
sp|P46862|PUNA_MYCLE Purine nucleoside phosphorylase OS=Mycobacterium leprae (strain TN) GN=punA PE=3 SV=1 69 344 1.0E-39
sp|P9WP01|PUNA_MYCTU Purine nucleoside phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=punA PE=1 SV=1 69 344 5.0E-39
sp|P9WP00|PUNA_MYCTO Purine nucleoside phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=punA PE=3 SV=1 69 344 5.0E-39
sp|P0A539|PUNA_MYCBO Purine nucleoside phosphorylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=punA PE=3 SV=1 69 344 5.0E-39
sp|P81989|PUNA_CELSP Purine nucleoside phosphorylase OS=Cellulomonas sp. GN=punA PE=1 SV=1 71 305 8.0E-30
sp|Q8U2I1|PNPH_PYRFU Probable 6-oxopurine nucleoside phosphorylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0853 PE=1 SV=1 67 347 3.0E-19
sp|Q8U4Q8|MTAP_PYRFU S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=mtnP PE=1 SV=1 67 344 4.0E-19
sp|Q9V2F1|MTAP_PYRAB S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=mntP PE=3 SV=1 67 344 8.0E-19
sp|O57865|MTAP_PYRHO S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=mtnP PE=3 SV=2 67 344 2.0E-18
sp|Q2RKL6|PNPH_MOOTA Probable 6-oxopurine nucleoside phosphorylase OS=Moorella thermoacetica (strain ATCC 39073) GN=Moth_0705 PE=3 SV=1 68 344 8.0E-18
sp|Q5JJB8|PNPH_THEKO Probable 6-oxopurine nucleoside phosphorylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1482 PE=3 SV=1 67 347 8.0E-18
sp|F6RQL9|MTAP_MACMU S-methyl-5'-thioadenosine phosphorylase OS=Macaca mulatta GN=MTAP PE=3 SV=1 68 340 2.0E-15
sp|Q13126|MTAP_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens GN=MTAP PE=1 SV=2 68 340 2.0E-15
sp|Q9CQ65|MTAP_MOUSE S-methyl-5'-thioadenosine phosphorylase OS=Mus musculus GN=Mtap PE=1 SV=1 68 340 4.0E-15
sp|Q7ZV22|MTAP_DANRE S-methyl-5'-thioadenosine phosphorylase OS=Danio rerio GN=mtap PE=2 SV=2 68 340 1.0E-14
sp|Q8ZTB2|MTAP_PYRAE S-methyl-5'-thioadenosine phosphorylase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=mtnP PE=3 SV=1 67 304 3.0E-14
sp|O66839|PNPH_AQUAE Probable 6-oxopurine nucleoside phosphorylase OS=Aquifex aeolicus (strain VF5) GN=aq_568 PE=3 SV=1 69 347 6.0E-14
sp|Q5JEQ6|MTAP_THEKO S-methyl-5'-thioadenosine phosphorylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=mtnP PE=3 SV=1 67 291 2.0E-13
sp|Q291H4|MTAP_DROPS S-methyl-5'-thioadenosine phosphorylase OS=Drosophila pseudoobscura pseudoobscura GN=GA18442 PE=3 SV=1 68 330 3.0E-13
sp|B8E181|PNPH_DICTD Probable 6-oxopurine nucleoside phosphorylase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=Dtur_0928 PE=3 SV=1 147 288 4.0E-13
sp|Q74E52|MTAP_GEOSL S-methyl-5'-thioadenosine phosphorylase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mtnP PE=3 SV=1 69 348 1.0E-12
sp|O27633|MTIP_METTH Probable S-methyl-5'-thioinosine phosphorylase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1596 PE=3 SV=1 144 304 2.0E-12
sp|Q297F5|PNPH_DROPS Purine nucleoside phosphorylase OS=Drosophila pseudoobscura pseudoobscura GN=GA16019 PE=3 SV=2 144 348 4.0E-12
sp|A1RXU2|MTAP_THEPD S-methyl-5'-thioadenosine phosphorylase OS=Thermofilum pendens (strain Hrk 5) GN=mtnP PE=3 SV=1 108 291 4.0E-12
sp|Q9V813|MTAP_DROME S-methyl-5'-thioadenosine phosphorylase OS=Drosophila melanogaster GN=Mtap PE=2 SV=1 118 330 5.0E-12
sp|Q8IMU4|PNPH_DROME Purine nucleoside phosphorylase OS=Drosophila melanogaster GN=CG31115 PE=3 SV=2 56 289 2.0E-11
sp|Q60367|MTIP_METJA Probable S-methyl-5'-thioinosine phosphorylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0060 PE=3 SV=1 144 288 3.0E-11
sp|Q87ZC3|MTIP_PSESM Probable S-methyl-5'-thioinosine phosphorylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_3506 PE=3 SV=1 71 288 3.0E-11
sp|Q8TQX8|MTIP_METAC Probable S-methyl-5'-thioinosine phosphorylase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1409 PE=3 SV=1 150 311 3.0E-11
sp|Q8TZB4|MTIP_METKA Probable S-methyl-5'-thioinosine phosphorylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0021 PE=3 SV=1 147 288 4.0E-11
sp|Q3MHF7|MTAP_BOVIN S-methyl-5'-thioadenosine phosphorylase OS=Bos taurus GN=MTAP PE=1 SV=1 68 340 4.0E-11
sp|Q2RXH9|MTAP_RHORT S-methyl-5'-thioadenosine phosphorylase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mtnP PE=3 SV=1 65 303 5.0E-11
sp|Q97W94|MTAP_SULSO S-methyl-5'-thioadenosine phosphorylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=mtnP PE=1 SV=1 65 292 5.0E-11
sp|F6V515|MTAP_XENTR S-methyl-5'-thioadenosine phosphorylase OS=Xenopus tropicalis GN=mtap PE=3 SV=1 68 340 8.0E-11
sp|Q89VT5|MTAP_BRADU S-methyl-5'-thioadenosine phosphorylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mtnP PE=3 SV=1 64 299 8.0E-11
sp|B5YKP5|MTIP_THEYD Probable S-methyl-5'-thioinosine phosphorylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=THEYE_A0977 PE=3 SV=1 147 275 8.0E-11
sp|A0RVQ7|MTAP_CENSY S-methyl-5'-thioadenosine phosphorylase OS=Cenarchaeum symbiosum (strain A) GN=mtnP PE=3 SV=1 110 344 2.0E-10
sp|B1L719|PNPH_KORCO Probable 6-oxopurine nucleoside phosphorylase OS=Korarchaeum cryptofilum (strain OPF8) GN=Kcr_1502 PE=3 SV=1 68 288 3.0E-10
sp|Q9HL98|MTAP_THEAC S-methyl-5'-thioadenosine phosphorylase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=mtnP PE=3 SV=1 69 291 6.0E-10
sp|Q9HZK1|MTIP_PSEAE S-methyl-5'-thioinosine phosphorylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3004 PE=1 SV=1 71 288 1.0E-09
sp|A9A3N5|MTAP_NITMS S-methyl-5'-thioadenosine phosphorylase OS=Nitrosopumilus maritimus (strain SCM1) GN=mtnP PE=3 SV=1 144 316 4.0E-09
sp|Q16MW6|MTAP_AEDAE S-methyl-5'-thioadenosine phosphorylase OS=Aedes aegypti GN=AAEL012172 PE=3 SV=1 144 288 1.0E-08
sp|Q9PAZ2|MTIP_XYLFA Probable S-methyl-5'-thioinosine phosphorylase OS=Xylella fastidiosa (strain 9a5c) GN=XF_2353 PE=3 SV=1 144 288 1.0E-08
sp|Q87BR7|MTIP_XYLFT Probable S-methyl-5'-thioinosine phosphorylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mtnP PE=3 SV=1 144 288 2.0E-08
sp|Q7Q9N9|MTAP_ANOGA S-methyl-5'-thioadenosine phosphorylase OS=Anopheles gambiae GN=AGAP005129 PE=3 SV=4 64 304 3.0E-08
sp|Q3J5E8|MTAP_RHOS4 S-methyl-5'-thioadenosine phosphorylase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mtnP PE=3 SV=1 69 299 3.0E-08
sp|F6X2V8|MTAP_CIOIN S-methyl-5'-thioadenosine phosphorylase OS=Ciona intestinalis PE=3 SV=1 63 302 4.0E-08
sp|A2BIU4|MTAP_HYPBU S-methyl-5'-thioadenosine phosphorylase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=mtnP PE=3 SV=1 69 347 4.0E-08
sp|Q7VDN6|MTAP_PROMA S-methyl-5'-thioadenosine phosphorylase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mtnP PE=3 SV=1 64 288 5.0E-08
sp|Q9YAQ8|MTAP_AERPE S-methyl-5'-thioadenosine phosphorylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=mtnP PE=1 SV=1 61 291 1.0E-07
sp|Q8DJE4|MTAP_THEEB S-methyl-5'-thioadenosine phosphorylase OS=Thermosynechococcus elongatus (strain BP-1) GN=mtnP PE=3 SV=1 68 303 2.0E-07
sp|A7SN31|MTAP_NEMVE S-methyl-5'-thioadenosine phosphorylase OS=Nematostella vectensis GN=v1g214799 PE=3 SV=1 151 288 2.0E-07
sp|E3XFR6|MTAP_ANODA S-methyl-5'-thioadenosine phosphorylase OS=Anopheles darlingi GN=AND_22863 PE=3 SV=1 144 326 8.0E-07
sp|Q1INC3|MTAP_KORVE S-methyl-5'-thioadenosine phosphorylase OS=Koribacter versatilis (strain Ellin345) GN=mtnP PE=3 SV=1 66 299 9.0E-07
sp|Q7NHW1|MTAP_GLOVI S-methyl-5'-thioadenosine phosphorylase OS=Gloeobacter violaceus (strain PCC 7421) GN=mtnP PE=3 SV=1 66 303 2.0E-06
sp|Q8PB40|MTIP_XANCP Probable S-methyl-5'-thioinosine phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC1285 PE=3 SV=1 210 288 3.0E-06
sp|A0QR54|MTAP_MYCS2 S-methyl-5'-thioadenosine phosphorylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtnP PE=1 SV=1 113 289 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009116 nucleoside metabolic process Yes
GO:0003824 catalytic activity Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:1901657 glycosyl compound metabolic process No
GO:0008152 metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|715700
MICMIRKFVWKLIFFSQSAVGLLPYTPEPPQFLKDKSTTDHQKGMKTNILSTVEYIRSQLPPELQQPRVGIVCGS
GLSGLAGIIQNIHTIPYANIPGFGTSTVPGHRSELAFGLLGKNGVPVVAMLGRFHFYEGHPLSTVVYPIRVMARL
GITEILITNAAGSLNPDIPTGTIVVVHDHIAFPGMTGTNPLMGPQTSPDHPRFLALSDAYSTSLRRLLFLAAHQL
SLSKSALAEGTYAWVSGPNYETPAEGIFLRSIGVDVVGMSTVPEVLVAREEGLKVMVLSLVTNLVVIPPSYKSIR
EEVEAELAGQSFVTPEEQVVSHDEVLAVGKEKAEVIKSLVQRVVELLS*
Coding >Agabi119p4|715700
ATGATATGTATGATCCGTAAGTTTGTTTGGAAATTGATCTTCTTCTCCCAATCGGCGGTTGGACTCCTACCATAT
ACCCCTGAACCTCCTCAATTTCTCAAAGATAAATCGACGACCGATCATCAAAAAGGGATGAAAACAAATATTCTT
TCTACAGTCGAGTATATCAGGTCTCAGCTCCCTCCGGAGCTCCAGCAGCCCCGAGTTGGGATCGTGTGTGGATCC
GGTTTAAGTGGCCTCGCTGGGATTATTCAAAACATTCATACAATACCATATGCAAATATACCAGGTTTCGGGACT
AGCACAGTGCCAGGACATCGGAGCGAGCTCGCTTTTGGCTTGTTAGGCAAGAATGGTGTTCCAGTCGTCGCGATG
TTAGGAAGGTTTCACTTCTATGAAGGTCATCCCTTGTCAACTGTCGTTTATCCTATCCGAGTTATGGCAAGGTTG
GGTATCACGGAAATCTTGATAACCAACGCTGCCGGGTCTCTAAATCCAGATATCCCTACTGGAACCATTGTTGTT
GTTCATGATCACATTGCATTCCCTGGTATGACTGGGACGAACCCATTGATGGGGCCTCAAACTTCCCCGGACCAC
CCTCGTTTTCTTGCCCTTTCCGATGCATACTCCACTTCTCTCCGTCGCCTCCTTTTCCTGGCCGCCCATCAACTG
TCTCTCAGTAAATCTGCTTTGGCGGAAGGAACTTACGCTTGGGTTTCTGGGCCAAATTACGAAACTCCGGCAGAA
GGTATATTCCTGAGGAGCATTGGTGTTGATGTTGTGGGTATGAGCACAGTTCCCGAAGTCCTTGTAGCTAGGGAA
GAGGGCTTGAAAGTGATGGTGCTTAGCCTTGTTACCAACTTGGTTGTTATTCCTCCGTCGTATAAGAGTATCCGA
GAGGAGGTCGAAGCGGAGCTTGCAGGACAGTCTTTTGTTACGCCAGAGGAGCAAGTCGTATCGCATGACGAGGTA
CTTGCCGTGGGCAAGGAGAAAGCAGAAGTTATAAAAAGCCTTGTGCAGCGAGTAGTAGAACTCCTGTCCTAA
Transcript >Agabi119p4|715700
ATGATATGTATGATCCGTAAGTTTGTTTGGAAATTGATCTTCTTCTCCCAATCGGCGGTTGGACTCCTACCATAT
ACCCCTGAACCTCCTCAATTTCTCAAAGATAAATCGACGACCGATCATCAAAAAGGGATGAAAACAAATATTCTT
TCTACAGTCGAGTATATCAGGTCTCAGCTCCCTCCGGAGCTCCAGCAGCCCCGAGTTGGGATCGTGTGTGGATCC
GGTTTAAGTGGCCTCGCTGGGATTATTCAAAACATTCATACAATACCATATGCAAATATACCAGGTTTCGGGACT
AGCACAGTGCCAGGACATCGGAGCGAGCTCGCTTTTGGCTTGTTAGGCAAGAATGGTGTTCCAGTCGTCGCGATG
TTAGGAAGGTTTCACTTCTATGAAGGTCATCCCTTGTCAACTGTCGTTTATCCTATCCGAGTTATGGCAAGGTTG
GGTATCACGGAAATCTTGATAACCAACGCTGCCGGGTCTCTAAATCCAGATATCCCTACTGGAACCATTGTTGTT
GTTCATGATCACATTGCATTCCCTGGTATGACTGGGACGAACCCATTGATGGGGCCTCAAACTTCCCCGGACCAC
CCTCGTTTTCTTGCCCTTTCCGATGCATACTCCACTTCTCTCCGTCGCCTCCTTTTCCTGGCCGCCCATCAACTG
TCTCTCAGTAAATCTGCTTTGGCGGAAGGAACTTACGCTTGGGTTTCTGGGCCAAATTACGAAACTCCGGCAGAA
GGTATATTCCTGAGGAGCATTGGTGTTGATGTTGTGGGTATGAGCACAGTTCCCGAAGTCCTTGTAGCTAGGGAA
GAGGGCTTGAAAGTGATGGTGCTTAGCCTTGTTACCAACTTGGTTGTTATTCCTCCGTCGTATAAGAGTATCCGA
GAGGAGGTCGAAGCGGAGCTTGCAGGACAGTCTTTTGTTACGCCAGAGGAGCAAGTCGTATCGCATGACGAGGTA
CTTGCCGTGGGCAAGGAGAAAGCAGAAGTTATAAAAAGCCTTGTGCAGCGAGTAGTAGAACTCCTGTCCTAA
Gene >Agabi119p4|715700
ATGATATGTATGATCCGTAAGTTTGTTTGGAAATTGATCTTCTTCTCCCAATCGGCGGTTGGACTCCTACCATAT
ACCCCTGAACCTCCTCAATTTCTCAAAGATAAATCGACGACCGATCATCAAAAAGGGATGAAAACAAATATTCTT
TCTACAGTCGAGTATATCAGGTCTCAGCTCCCTCCGGAGCTCCAGCAGCCCCGAGTTGGGATCGTGTGTGGATCC
GGTTTAAGTGGCCTCGCTGGGATTATTCAAAACATTCATACAATACCATATGCAAATATACCAGGTTTCGGGACT
AGCACAGGTATTGTAATCTGTATATACATACATCATCCTCAATACTAAACTGTACCCAAGTGCCAGGACATCGGA
GCGAGCTCGCTTTTGGCTTGTTAGGCAAGAATGGTGTTCCAGTCGTCGCGATGTTAGGAAGGGTAAGTACTTGGG
TTATGTGCTGCCCTTCAAATCACTTCATAGACGTTCCGCAAGTTTCACTTCTATGAAGGTCATCCCTTGTCAACT
GTCGTTTATCCTATCCGAGTTATGGCAAGGTTGGGTATCACGGAAATCTTGAGTACGTTCAAGAGCTGTTTTTAT
CCTAAATGTCAAATGTAATGACATCTCGTAGTAACCAACGCTGCCGGGTCTCTAAATCCAGATATCCCTACTGGA
ACCAGTACGTCTCATCGAATAAATTTCAGTGATAACTTCTCATGAAAATCTCACCAAGTTGTTGTTGTTCATGAT
CACATTGCATTCCCTGGTATGACTGGGACGAACCCATTGATGGGGCCTCAAACTTCCCCGGACCACCCTCGTTTT
CTTGCCCTTTCCGATGCATACTCCACTTCTCTCCGTCGCCTCCTTTTCCTGGCCGCCCATCAACTGTCTCTCAGT
AAATCTGCTTTGGCGGAAGGAACTTACGCTTGGGTTTCTGGGCCAAATTACGAAACTCCGGCAGAAGGTATATTC
CTGAGGAGCATTGGTGTTGATGTTGTGGGTATGAGCACAGTTCCCGAAGTCCTTGTAGCTAGGGAAGAGGGCTTG
AAAGTGATGGTGCTTAGCCTTGTTACCAACTTGGTTGTTATTCCTCCGTCGTATAAGAGTATCCGAGAGGAGGTC
GAAGCGGAGGTTCATATCTTTCAAATGACTATTCTTTCGAATTACGACTAACTCAGTGAATTTACAGCTTGCAGG
ACAGTCTTTTGTTACGCCAGAGGAGCAAGTCGTATCGCATGACGAGGTACTTGCCGTGGGCAAGGAGAAAGCAGA
AGTTATAAAAAGCCTTGTGCAGCGAGTAGTAGAACTCCTGTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail