Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|713150
Gene name
Locationscaffold_09:747663..749323
Strand+
Gene length (bp)1660
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14327 CSTF2_hinge Hinge domain of cleavage stimulation factor subunit 2 7.5E-29 123 202
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.2E-19 5 75
PF14304 CSTF_C Transcription termination and cleavage factor C-terminal 5.6E-11 302 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 3 274 2.0E-41
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 3 204 5.0E-41
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 3 204 6.0E-41
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 3 204 8.0E-41
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 3 204 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 3 274 2.0E-41
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 3 204 5.0E-41
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 3 204 6.0E-41
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 3 204 8.0E-41
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 3 204 3.0E-40
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 3 204 3.0E-40
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 3 199 7.0E-38
sp|Q9P6P7|YKCG_SCHPO Uncharacterized RNA-binding protein C644.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.16 PE=3 SV=1 2 202 2.0E-37
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 3 83 3.0E-22
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 2 193 3.0E-19
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 2 80 2.0E-13
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 2 79 2.0E-12
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 1 77 6.0E-12
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 5 92 8.0E-12
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 5 92 8.0E-12
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 5 83 8.0E-12
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 5 92 9.0E-12
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 2 77 2.0E-11
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 2 77 2.0E-11
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 2 77 2.0E-11
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 5 80 2.0E-11
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 5 83 3.0E-11
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 5 83 3.0E-11
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 5 83 3.0E-11
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 1 79 5.0E-11
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 5 76 7.0E-11
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 104 335 8.0E-11
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 2 77 8.0E-11
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 4 83 9.0E-11
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 5 79 2.0E-10
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 2 79 2.0E-10
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 2 83 2.0E-10
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 5 80 3.0E-10
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 1 83 3.0E-10
sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 5 97 6.0E-10
sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=1 SV=1 5 97 6.0E-10
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 2 79 7.0E-10
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 5 81 8.0E-10
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 2 83 8.0E-10
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 5 81 1.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 5 83 2.0E-09
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 5 79 2.0E-09
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 5 86 2.0E-09
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 1 81 3.0E-09
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 2 80 3.0E-09
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 5 83 3.0E-09
sp|Q5R5P4|RBM47_PONAB RNA-binding protein 47 OS=Pongo abelii GN=RBM47 PE=2 SV=2 5 76 3.0E-09
sp|A0AV96|RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens GN=RBM47 PE=1 SV=2 5 76 3.0E-09
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 5 77 4.0E-09
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 2 80 4.0E-09
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 5 80 4.0E-09
sp|Q2R0Q1|U2A2A_ORYSJ Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2 5 80 4.0E-09
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 5 79 5.0E-09
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 5 83 6.0E-09
sp|Q2QZL4|U2A2B_ORYSJ Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=3 SV=2 5 80 6.0E-09
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 5 78 7.0E-09
sp|Q2QKB4|U2A2B_WHEAT Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1 5 80 7.0E-09
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 5 80 8.0E-09
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 2 79 9.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 5 79 1.0E-08
sp|Q9XSR3|RBM47_CANLF RNA-binding protein 47 OS=Canis lupus familiaris GN=RBM47 PE=2 SV=1 5 76 1.0E-08
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 5 81 1.0E-08
sp|Q2QKB3|U2A2A_WHEAT Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1 5 80 1.0E-08
sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 5 79 1.0E-08
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 4 76 1.0E-08
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 4 76 1.0E-08
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 2 80 1.0E-08
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 5 79 1.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 5 78 2.0E-08
sp|Q0P4R6|RBM46_XENTR Probable RNA-binding protein 46 OS=Xenopus tropicalis GN=rbm46 PE=2 SV=1 5 69 2.0E-08
sp|Q9H0Z9|RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2 5 79 2.0E-08
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 5 79 2.0E-08
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 5 79 3.0E-08
sp|P86049|RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=1 SV=1 5 69 3.0E-08
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 2 79 3.0E-08
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 5 79 4.0E-08
sp|Q76LC6|RBM24_DANRE RNA-binding protein 24 OS=Danio rerio GN=rbm24 PE=2 SV=1 5 79 4.0E-08
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 2 77 4.0E-08
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 5 84 4.0E-08
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 5 84 4.0E-08
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 5 84 4.0E-08
sp|Q8TBY0|RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1 5 69 4.0E-08
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 5 84 4.0E-08
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 5 84 4.0E-08
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 5 82 4.0E-08
sp|P36629|U2AF2_SCHPO Splicing factor U2AF 59 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp2 PE=1 SV=1 5 79 5.0E-08
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 4 79 5.0E-08
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 5 83 5.0E-08
sp|Q3SZM1|MK67I_BOVIN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus GN=NIFK PE=2 SV=1 4 78 5.0E-08
sp|Q4R2Z0|RBM46_MACFA Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2 5 69 5.0E-08
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 5 79 6.0E-08
sp|Q9CZ96|ZCRB1_MOUSE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Mus musculus GN=Zcrb1 PE=1 SV=1 4 79 7.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 5 79 7.0E-08
sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 5 79 7.0E-08
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 2 80 7.0E-08
sp|Q499V6|ZCRB1_RAT Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Rattus norvegicus GN=Zcrb1 PE=2 SV=1 4 79 8.0E-08
sp|Q5ZJX4|RBM38_CHICK RNA-binding protein 38 OS=Gallus gallus GN=RBM38 PE=2 SV=1 5 79 8.0E-08
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 5 77 9.0E-08
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 5 79 9.0E-08
sp|Q6GQD3|RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis GN=rbm24-a PE=2 SV=1 5 79 9.0E-08
sp|Q6P8A7|RBM24_XENTR RNA-binding protein 24 OS=Xenopus tropicalis GN=rbm24 PE=2 SV=1 5 79 1.0E-07
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 5 79 2.0E-07
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 5 79 2.0E-07
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 3 79 2.0E-07
sp|Q9BX46|RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens GN=RBM24 PE=1 SV=1 5 79 2.0E-07
sp|Q5ZMA3|RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus GN=RBM24 PE=2 SV=2 5 79 2.0E-07
sp|P40561|SGN1_YEAST RNA-binding protein SGN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGN1 PE=1 SV=1 2 76 2.0E-07
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 4 78 2.0E-07
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 5 76 2.0E-07
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 5 79 2.0E-07
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 5 81 2.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 5 79 2.0E-07
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 5 79 3.0E-07
sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 5 79 3.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 5 79 3.0E-07
sp|Q6DIV4|RBM38_XENTR RNA-binding protein 38 OS=Xenopus tropicalis GN=rbm38 PE=2 SV=1 5 79 3.0E-07
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 5 79 3.0E-07
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 4 76 3.0E-07
sp|P40565|IST3_YEAST U2 snRNP component IST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST3 PE=1 SV=1 5 77 3.0E-07
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 4 88 3.0E-07
sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=1 SV=1 5 79 3.0E-07
sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 5 79 3.0E-07
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 5 79 3.0E-07
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 5 79 3.0E-07
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 5 79 3.0E-07
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 5 79 3.0E-07
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 5 80 3.0E-07
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 5 102 3.0E-07
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 5 79 3.0E-07
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 5 77 4.0E-07
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 5 79 4.0E-07
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 4 81 4.0E-07
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 5 79 4.0E-07
sp|Q54ZS8|PABP2_DICDI Polyadenylate-binding protein 2 OS=Dictyostelium discoideum GN=pabpn1 PE=3 SV=1 2 76 4.0E-07
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 4 81 4.0E-07
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 4 81 4.0E-07
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 5 105 5.0E-07
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 1 79 5.0E-07
sp|Q5YD48|A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus GN=A1cf PE=1 SV=2 5 96 5.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 5 79 5.0E-07
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 5 79 5.0E-07
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 5 79 5.0E-07
sp|Q8TBF4|ZCRB1_HUMAN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens GN=ZCRB1 PE=1 SV=2 4 79 5.0E-07
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 4 92 5.0E-07
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 2 80 5.0E-07
sp|Q08BH5|RBM46_DANRE Probable RNA-binding protein 46 OS=Danio rerio GN=rbm46 PE=2 SV=1 5 69 6.0E-07
sp|Q923K9|A1CF_RAT APOBEC1 complementation factor OS=Rattus norvegicus GN=A1cf PE=1 SV=1 5 96 6.0E-07
sp|Q7T3I7|RBM38_XENLA RNA-binding protein 38 OS=Xenopus laevis GN=rbm38 PE=1 SV=2 5 79 6.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 5 79 6.0E-07
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 5 76 6.0E-07
sp|P53927|NOP15_YEAST Ribosome biogenesis protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP15 PE=1 SV=1 4 76 6.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 5 79 6.0E-07
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 5 76 7.0E-07
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 1 80 7.0E-07
sp|Q9P383|NCBP2_SCHPO Nuclear cap-binding protein subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc2 PE=3 SV=1 2 108 7.0E-07
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 3 76 7.0E-07
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 5 79 8.0E-07
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 5 77 8.0E-07
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 5 79 8.0E-07
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 2 79 8.0E-07
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 5 79 8.0E-07
sp|Q66KL9|RBM42_XENTR RNA-binding protein 42 OS=Xenopus tropicalis GN=rbm42 PE=2 SV=1 5 76 9.0E-07
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 5 96 1.0E-06
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 5 76 1.0E-06
sp|Q6AXT7|RBM42_RAT RNA-binding protein 42 OS=Rattus norvegicus GN=Rbm42 PE=1 SV=1 5 76 1.0E-06
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 5 90 1.0E-06
sp|Q91V81|RBM42_MOUSE RNA-binding protein 42 OS=Mus musculus GN=Rbm42 PE=1 SV=1 5 76 1.0E-06
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 5 76 1.0E-06
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 5 76 1.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 5 79 1.0E-06
sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus GN=RBM42 PE=2 SV=1 5 76 1.0E-06
sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus GN=ZCRB1 PE=2 SV=1 4 79 1.0E-06
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 1 122 1.0E-06
sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 4 119 2.0E-06
sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 5 69 2.0E-06
sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 5 69 2.0E-06
sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 5 69 2.0E-06
sp|Q9BTD8|RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens GN=RBM42 PE=1 SV=1 5 76 2.0E-06
sp|Q9FVQ1|NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana GN=NUCL1 PE=1 SV=1 2 79 2.0E-06
sp|Q6DCB7|DND1_XENLA Dead end protein homolog 1 OS=Xenopus laevis GN=dnd1 PE=2 SV=2 5 102 2.0E-06
sp|A8Y1R8|NCBP2_CAEBR Nuclear cap-binding protein subunit 2 OS=Caenorhabditis briggsae GN=ncbp-2 PE=3 SV=2 2 94 2.0E-06
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 5 80 2.0E-06
sp|Q66II8|RU17_XENTR U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus tropicalis GN=snrnp70 PE=2 SV=1 3 78 2.0E-06
sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 3 78 2.0E-06
sp|A8WLV5|EIF3G_CAEBR Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis briggsae GN=eif-3.G.1 PE=3 SV=2 7 78 2.0E-06
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 5 79 2.0E-06
sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 5 96 2.0E-06
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 5 79 2.0E-06
sp|Q93594|NCBP2_CAEEL Nuclear cap-binding protein subunit 2 OS=Caenorhabditis elegans GN=ncbp-2 PE=3 SV=2 2 94 2.0E-06
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 5 77 3.0E-06
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 5 76 3.0E-06
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 5 76 3.0E-06
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 5 76 3.0E-06
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 5 76 3.0E-06
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 5 76 3.0E-06
sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 5 96 3.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 5 85 3.0E-06
sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 3 78 3.0E-06
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 5 79 3.0E-06
sp|Q19706|EIF3G_CAEEL Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis elegans GN=eif-3.G PE=3 SV=2 7 78 3.0E-06
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 5 80 3.0E-06
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 5 95 3.0E-06
sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 3 78 3.0E-06
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 2 88 4.0E-06
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 5 79 4.0E-06
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 4 80 5.0E-06
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 3 66 5.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 5 76 5.0E-06
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 5 95 5.0E-06
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 5 95 5.0E-06
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 5 95 5.0E-06
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 5 82 5.0E-06
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 2 95 5.0E-06
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 5 79 5.0E-06
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 5 80 6.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 2 93 6.0E-06
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 5 79 6.0E-06
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 5 80 6.0E-06
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 5 95 7.0E-06
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 5 79 7.0E-06
sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 1 128 7.0E-06
sp|Q5SP50|ZCRB1_DANRE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Danio rerio GN=zcrb1 PE=2 SV=1 4 79 7.0E-06
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 5 91 8.0E-06
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 5 95 8.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 5 79 8.0E-06
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 5 95 8.0E-06
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 17 81 8.0E-06
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 5 95 9.0E-06
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 5 88 9.0E-06
sp|Q9XFD1|NCBP2_ARATH Nuclear cap-binding protein subunit 2 OS=Arabidopsis thaliana GN=CBP20 PE=1 SV=1 2 93 1.0E-05
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 2 85 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0031124 mRNA 3'-end processing Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0006396 RNA processing No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006397 mRNA processing No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016071 mRNA metabolic process No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0031123 RNA 3'-end processing No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|713150
MSKVVFVGNVPYNMGEDQLIDVFKSVGQVIGFRLVFDRETGKPRGYGFCEFADNETALSAVRNLNNVDVGGRPLR
IDLADSDPFLEGKTTVRGELVDGGYPGPAEPRQRGGGRGHDGDFLSQVPLGVPIPKGTKALDHISTTLAKMQPSQ
LMEVLAQMKAFIITHPDQARQLLVKHPQLSYALFQGLLLNNIVDPAILQRMLEQTASQQMNPGTTSTPPRPPMPP
HLSQQSPFVPPPSHMSYQAPALMSGLPPPSSLPPASAMFPTTGVPYYRPPPPAAAPQAPAPPVAAQQPAATPAIN
ENQRAMLMQVLALTPDQISGLPESEKAAIMQLRTQFGKITT*
Coding >Agabi119p4|713150
ATGAGCAAAGTAGTTTTTGTTGGAAATGTGCCATACAACATGGGTGAAGACCAGCTTATTGACGTATTTAAAAGC
GTCGGGCAAGTTATAGGATTCAGGCTGGTCTTTGACCGGGAAACGGGTAAACCTCGTGGATATGGGTTTTGCGAG
TTTGCTGACAATGAAACTGCGCTGAGTGCTGTTCGAAACCTCAATAATGTTGATGTTGGTGGACGACCGCTAAGG
ATCGACCTGGCGGACTCTGATCCATTTCTTGAAGGCAAAACAACAGTCCGTGGTGAATTAGTAGATGGTGGATAT
CCTGGACCTGCGGAACCTCGACAACGCGGCGGAGGTCGTGGACACGATGGCGACTTCCTATCTCAAGTTCCTCTC
GGTGTCCCCATTCCAAAAGGAACAAAAGCATTGGACCATATTAGTACAACTCTCGCAAAAATGCAGCCTAGCCAA
CTAATGGAGGTCCTGGCCCAGATGAAGGCATTCATCATCACGCATCCCGACCAAGCACGTCAACTTCTTGTCAAG
CATCCTCAGCTATCTTACGCGCTTTTCCAAGGTCTGCTGCTGAACAACATCGTTGATCCTGCAATTCTACAACGA
ATGCTTGAGCAGACCGCGTCACAGCAGATGAATCCGGGGACAACTTCAACGCCTCCGCGCCCGCCGATGCCTCCT
CATTTATCTCAACAATCTCCATTCGTCCCTCCTCCATCTCACATGTCATACCAGGCGCCAGCACTTATGTCTGGA
TTGCCTCCGCCTTCATCGCTGCCGCCCGCATCAGCAATGTTCCCTACCACGGGCGTTCCGTATTATCGGCCACCG
CCTCCTGCTGCTGCACCGCAAGCCCCCGCACCACCTGTAGCAGCCCAACAGCCTGCCGCAACGCCCGCAATAAAT
GAAAACCAAAGGGCCATGCTCATGCAAGTGCTTGCTTTGACGCCAGATCAAATTAGCGGACTTCCGGAGAGCGAG
AAGGCGGCGATAATGCAACTGCGTACTCAATTTGGCAAGATAACTACATAG
Transcript >Agabi119p4|713150
ATGAGCAAAGTAGTTTTTGTTGGAAATGTGCCATACAACATGGGTGAAGACCAGCTTATTGACGTATTTAAAAGC
GTCGGGCAAGTTATAGGATTCAGGCTGGTCTTTGACCGGGAAACGGGTAAACCTCGTGGATATGGGTTTTGCGAG
TTTGCTGACAATGAAACTGCGCTGAGTGCTGTTCGAAACCTCAATAATGTTGATGTTGGTGGACGACCGCTAAGG
ATCGACCTGGCGGACTCTGATCCATTTCTTGAAGGCAAAACAACAGTCCGTGGTGAATTAGTAGATGGTGGATAT
CCTGGACCTGCGGAACCTCGACAACGCGGCGGAGGTCGTGGACACGATGGCGACTTCCTATCTCAAGTTCCTCTC
GGTGTCCCCATTCCAAAAGGAACAAAAGCATTGGACCATATTAGTACAACTCTCGCAAAAATGCAGCCTAGCCAA
CTAATGGAGGTCCTGGCCCAGATGAAGGCATTCATCATCACGCATCCCGACCAAGCACGTCAACTTCTTGTCAAG
CATCCTCAGCTATCTTACGCGCTTTTCCAAGGTCTGCTGCTGAACAACATCGTTGATCCTGCAATTCTACAACGA
ATGCTTGAGCAGACCGCGTCACAGCAGATGAATCCGGGGACAACTTCAACGCCTCCGCGCCCGCCGATGCCTCCT
CATTTATCTCAACAATCTCCATTCGTCCCTCCTCCATCTCACATGTCATACCAGGCGCCAGCACTTATGTCTGGA
TTGCCTCCGCCTTCATCGCTGCCGCCCGCATCAGCAATGTTCCCTACCACGGGCGTTCCGTATTATCGGCCACCG
CCTCCTGCTGCTGCACCGCAAGCCCCCGCACCACCTGTAGCAGCCCAACAGCCTGCCGCAACGCCCGCAATAAAT
GAAAACCAAAGGGCCATGCTCATGCAAGTGCTTGCTTTGACGCCAGATCAAATTAGCGGACTTCCGGAGAGCGAG
AAGGCGGCGATAATGCAACTGCGTACTCAATTTGGCAAGATAACTACATAG
Gene >Agabi119p4|713150
ATGAGCAAAGTAGTTTTTGGTCAGTCTCGCTGATCTCTCATATACCATCCAGTAGCTCAACTTTCTTCAGTTGGA
AATGTGCCATACAACATGGGTGAAGACCAGCTTATTGACGTATTTAAAAGCGTCGGGCAAGTTATAGGATTCAGG
TAATCAAGCGCATGGAATTGCTCTGTAAGTACACACCGAGCTGAGCGCGAGTGAATCAGGCTGGTCTTTGACCGG
GAAACGGGTAAACCTCGTGGATATGGGTTTTGCGAGTTTGCTGGTATGTCCTATTCCAAGCACGATCTATCGTGG
AACGCTAAGCACCAAGTTCAACCGACACATATTCCATCTCTGGCTTCAAACACGAAACCATAATCGTCATGACAA
CATTGGATTGCTATTGTCTGACCCGTGTTGGAACGTTTCATCCCTCTGCTGAATCTATCTACCTTCTGCTGTTGA
ACCCTTCGATGCCTCAAACGCGATTCTATCATTTGCAACTTTGACGCATGATGAATGAATTCGTGTGATTGCTTG
ATTCCTGATTTTTGAAAATTCGAATCATTCTTCAAATTTACTCCGCTTTCGTTGACCCGCGAATTTAATGTCATG
GACATCGCCAGACAATGAAACTGCGCTGAGTGCTGTTCGAAACCTCAATAATGTTGATGTTGGTGGACGACCGCT
AAGGATCGACCTGGCGGACTCTGATCCATTTCTTGAAGGCAAAACAACAGTCCGTGGTGAATTAGTAGATGGTGG
ATATCCTGGACCTGCGGAACCTCGACAACGCGGCGGAGGTCGTGGACACGATGGCGACTTCCTATCTCAAGTTCC
TCTCGGTGTCCCCATTCCAAAAGGAACAAAAGCATTGGACCATATTAGTACAACTCTCGCAAAAATGCAGCCTAG
CCAACTAATGGAGGTCCTGGCCCAGATGAAGGTATGCATTCGTTTTCGATCTGATCCAGCATTATCCAACATTCC
ATAGGCATTCATCATCACGCATCCCGACCAAGCACGTCAACTTCTTGTCAAGCATCCTCAGCTATCTTACGCGCT
TTTCCAAGGTCTGCTGCTGAACAACATCGTTGATCCTGCAATTCTACAACGAATGCTTGAGCAGACCGCGTCACA
GCAGATGAATCCGGGGACAACTTCAACGCCTCCGCGCCCGCCGATGCCTCCTCATTTATCTCAACAATCTCCATT
CGTCCCTCCTCCATCTCACATGTCATACCAGGCGCCAGCACTTATGTCTGGATTGCCTCCGCCTTCATCGCTGCC
GCCCGCATCAGCAATGTTCCCTACCACGGGCGTTCCGTATTATCGGCCACCGCCTCCTGCTGCTGCACCGCAAGC
CCCCGCACCACCTGTAGCAGCCCAACAGCCTGCCGCAACGCCCGCAATAAATGAAAACCAAAGGGTTGGTGTACT
CGCCTGCGGTTCTGGCTGCGAAATGACACGAACGCTGACCTTTTTTCGTAGGCCATGCTCATGCAAGTGCTTGCT
TTGACGCCAGATCAAATTAGCGGACTTCCGGAGAGCGAGAAGGCGGCGATAATGCAACTGGTGAGTTTAATTATA
TTATCGACCATGCTGTTCGACTAAGAGATGCTCGTCACACTTTACGAATCAATAGCGTACTCAATTTGGCAAGAT
AACTACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail