Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|711350
Gene name
Locationscaffold_09:368219..371078
Strand+
Gene length (bp)2859
Transcript length (bp)2226
Coding sequence length (bp)2226
Protein length (aa) 742

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18564 Glyco_hydro_5_C Glycoside hydrolase family 5 C-terminal domain 1.8E-19 575 692

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40566|YIS7_YEAST Uncharacterized glycosyl hydrolase YIR007W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR007W PE=1 SV=1 56 624 2.0E-58

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 718 740 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|711350
MFNLQSTDGSYILVDDAVRKHPSKGSQYKPGSVTSYAHDWSPLSTGGGIRLKGRDFVDGYGRVCNLRGVNLSGNC
KIPVNHSIEEFPDDPKAVTFIGHPFPLSEAHEHFSRLRKWGLTFIRFIVTWEAIEHQGPGIYDQEYLTYLRELLS
LLPKYGLIAYVSLHQDVWSRYTGGSGAPAWTVEAAGFDLNALEETGAAWLGGMRGGGHDETEKGLWPTGYHKLAA
STMNTLFWGGDTFAPKLKTEDGTSIQQFLQDAFLNAWDALVNARLHCPQVNLGAGHPTLVRGWTRSWPMPSRQTK
QTILNEGKKRAWKEDGPTKGQCLWEMHGVWGWCKTKNQAVVLRENYFLKHPVSGKKVDWYTDHYYPFLKNWADRV
LRATSSSKFLFVEPIPNEYCPPSWTEHRLPNMVYAPHWYDLYSLFNKSFGEFSVNVQGLSRGMFPLKAFYWGHVG
ARNNYSLQIRNLKEEAYKSLGNVPVIFGECGIPMDMNQGIAFTTEEFLWQRRMMDAMITGFDRSSVGFNLWNYNP
DNTDEHGDKWNGENFSWFSQRRAMPNFLLEYEQNTPHLDGGGRILDAIVRPYPAKVAGTPLDFSYEMMNGEFTFS
WMVPLQGVRDENELGSYETEIFLPSQLASGRKVLVETDVDWRKHDIDDGVAAQKKLKQWTEEKYAYRYDETRQTL
FIVPKNNSPGTKHAVRVRVWPPIRPVMNLNSFWSDFGVGVVTVGLLLAVLLAAAAMAMGTVWLGYT*
Coding >Agabi119p4|711350
ATGTTCAATCTCCAGTCCACCGATGGTTCTTATATTCTTGTGGACGACGCTGTACGCAAACACCCCTCAAAGGGA
TCTCAGTACAAGCCAGGCTCTGTAACATCATACGCCCACGATTGGTCTCCATTGAGTACAGGTGGTGGGATTCGT
CTAAAAGGACGAGATTTCGTTGATGGATACGGTCGTGTTTGTAACCTTCGTGGTGTTAATCTTTCAGGAAACTGT
AAAATTCCCGTCAACCATTCGATCGAGGAATTTCCTGATGACCCAAAGGCTGTGACTTTTATCGGACATCCCTTT
CCACTGTCTGAGGCCCATGAGCACTTCTCTAGGTTGAGGAAGTGGGGCTTAACATTCATTCGTTTTATTGTGACA
TGGGAGGCTATAGAACACCAAGGGCCTGGAATATATGACCAAGAATACCTAACGTATCTTCGCGAATTACTATCA
CTCCTGCCGAAATATGGTCTTATAGCATACGTTTCTCTTCACCAAGATGTCTGGTCTCGGTACACTGGCGGTTCT
GGTGCACCAGCGTGGACAGTTGAAGCTGCTGGCTTCGATCTGAACGCACTGGAAGAAACTGGCGCCGCCTGGTTG
GGGGGGATGCGCGGAGGCGGTCACGATGAAACAGAAAAAGGACTATGGCCGACTGGATATCACAAGCTTGCCGCG
TCGACAATGAATACCCTGTTTTGGGGTGGTGATACCTTTGCTCCCAAACTGAAGACTGAAGATGGTACTTCCATT
CAGCAATTCCTTCAAGACGCGTTTTTGAACGCGTGGGATGCTCTTGTGAATGCAAGGTTACATTGCCCTCAAGTC
AATCTGGGTGCTGGGCACCCGACGCTCGTACGAGGCTGGACTCGCTCGTGGCCCATGCCGTCGAGGCAGACAAAA
CAAACGATACTGAACGAAGGAAAGAAGAGGGCGTGGAAGGAAGATGGACCGACTAAGGGACAGTGTTTGTGGGAG
ATGCACGGTGTTTGGGGATGGTGTAAAACCAAAAACCAGGCAGTTGTGTTGAGGGAGAATTATTTCCTCAAGCAT
CCGGTCAGCGGAAAGAAGGTCGATTGGTACACCGACCATTACTATCCCTTTCTGAAAAATTGGGCGGATAGAGTG
CTGAGAGCGACGTCTTCGAGCAAATTCTTGTTCGTTGAACCTATACCCAATGAGTATTGCCCTCCTTCCTGGACA
GAACACCGCCTTCCCAACATGGTGTATGCGCCACATTGGTACGACTTGTACTCACTATTCAACAAGTCCTTTGGC
GAATTCTCTGTTAATGTTCAAGGCCTGTCGCGGGGAATGTTCCCTTTGAAAGCTTTCTACTGGGGTCACGTCGGT
GCTCGGAACAACTATAGTCTTCAAATTCGTAATCTGAAAGAAGAAGCATATAAATCTCTGGGCAATGTACCCGTG
ATATTCGGAGAATGTGGTATACCTATGGATATGAACCAAGGAATAGCCTTTACGACGGAGGAATTTCTTTGGCAG
AGACGGATGATGGATGCTATGATCACCGGCTTCGATCGGTCATCAGTCGGGTTCAACTTGTGGAACTACAACCCC
GATAACACCGACGAACACGGTGATAAGTGGAATGGCGAAAATTTTTCTTGGTTTTCTCAGCGCCGTGCAATGCCC
AACTTTTTACTCGAATACGAACAAAACACTCCTCATCTCGATGGTGGTGGTCGTATCCTCGATGCAATCGTCCGA
CCATATCCTGCAAAAGTAGCGGGTACACCGCTCGATTTCAGTTATGAGATGATGAATGGAGAATTTACGTTCTCG
TGGATGGTACCTCTTCAAGGCGTCAGAGATGAAAACGAATTAGGATCTTACGAAACTGAAATCTTCTTACCTTCA
CAACTCGCGTCCGGCAGAAAAGTGCTCGTGGAAACTGATGTTGATTGGAGAAAACATGACATTGATGATGGAGTC
GCAGCGCAGAAGAAGCTAAAGCAATGGACAGAAGAAAAATATGCATACAGATATGATGAGACCAGGCAAACGTTG
TTCATCGTACCGAAGAATAACTCTCCTGGGACGAAACATGCTGTGAGGGTTAGGGTGTGGCCGCCTATCAGACCG
GTGATGAATTTGAATAGTTTCTGGAGTGATTTTGGTGTAGGAGTCGTTACTGTTGGTCTTCTACTTGCTGTGTTG
CTCGCTGCGGCGGCGATGGCTATGGGTACTGTTTGGTTGGGCTATACATGA
Transcript >Agabi119p4|711350
ATGTTCAATCTCCAGTCCACCGATGGTTCTTATATTCTTGTGGACGACGCTGTACGCAAACACCCCTCAAAGGGA
TCTCAGTACAAGCCAGGCTCTGTAACATCATACGCCCACGATTGGTCTCCATTGAGTACAGGTGGTGGGATTCGT
CTAAAAGGACGAGATTTCGTTGATGGATACGGTCGTGTTTGTAACCTTCGTGGTGTTAATCTTTCAGGAAACTGT
AAAATTCCCGTCAACCATTCGATCGAGGAATTTCCTGATGACCCAAAGGCTGTGACTTTTATCGGACATCCCTTT
CCACTGTCTGAGGCCCATGAGCACTTCTCTAGGTTGAGGAAGTGGGGCTTAACATTCATTCGTTTTATTGTGACA
TGGGAGGCTATAGAACACCAAGGGCCTGGAATATATGACCAAGAATACCTAACGTATCTTCGCGAATTACTATCA
CTCCTGCCGAAATATGGTCTTATAGCATACGTTTCTCTTCACCAAGATGTCTGGTCTCGGTACACTGGCGGTTCT
GGTGCACCAGCGTGGACAGTTGAAGCTGCTGGCTTCGATCTGAACGCACTGGAAGAAACTGGCGCCGCCTGGTTG
GGGGGGATGCGCGGAGGCGGTCACGATGAAACAGAAAAAGGACTATGGCCGACTGGATATCACAAGCTTGCCGCG
TCGACAATGAATACCCTGTTTTGGGGTGGTGATACCTTTGCTCCCAAACTGAAGACTGAAGATGGTACTTCCATT
CAGCAATTCCTTCAAGACGCGTTTTTGAACGCGTGGGATGCTCTTGTGAATGCAAGGTTACATTGCCCTCAAGTC
AATCTGGGTGCTGGGCACCCGACGCTCGTACGAGGCTGGACTCGCTCGTGGCCCATGCCGTCGAGGCAGACAAAA
CAAACGATACTGAACGAAGGAAAGAAGAGGGCGTGGAAGGAAGATGGACCGACTAAGGGACAGTGTTTGTGGGAG
ATGCACGGTGTTTGGGGATGGTGTAAAACCAAAAACCAGGCAGTTGTGTTGAGGGAGAATTATTTCCTCAAGCAT
CCGGTCAGCGGAAAGAAGGTCGATTGGTACACCGACCATTACTATCCCTTTCTGAAAAATTGGGCGGATAGAGTG
CTGAGAGCGACGTCTTCGAGCAAATTCTTGTTCGTTGAACCTATACCCAATGAGTATTGCCCTCCTTCCTGGACA
GAACACCGCCTTCCCAACATGGTGTATGCGCCACATTGGTACGACTTGTACTCACTATTCAACAAGTCCTTTGGC
GAATTCTCTGTTAATGTTCAAGGCCTGTCGCGGGGAATGTTCCCTTTGAAAGCTTTCTACTGGGGTCACGTCGGT
GCTCGGAACAACTATAGTCTTCAAATTCGTAATCTGAAAGAAGAAGCATATAAATCTCTGGGCAATGTACCCGTG
ATATTCGGAGAATGTGGTATACCTATGGATATGAACCAAGGAATAGCCTTTACGACGGAGGAATTTCTTTGGCAG
AGACGGATGATGGATGCTATGATCACCGGCTTCGATCGGTCATCAGTCGGGTTCAACTTGTGGAACTACAACCCC
GATAACACCGACGAACACGGTGATAAGTGGAATGGCGAAAATTTTTCTTGGTTTTCTCAGCGCCGTGCAATGCCC
AACTTTTTACTCGAATACGAACAAAACACTCCTCATCTCGATGGTGGTGGTCGTATCCTCGATGCAATCGTCCGA
CCATATCCTGCAAAAGTAGCGGGTACACCGCTCGATTTCAGTTATGAGATGATGAATGGAGAATTTACGTTCTCG
TGGATGGTACCTCTTCAAGGCGTCAGAGATGAAAACGAATTAGGATCTTACGAAACTGAAATCTTCTTACCTTCA
CAACTCGCGTCCGGCAGAAAAGTGCTCGTGGAAACTGATGTTGATTGGAGAAAACATGACATTGATGATGGAGTC
GCAGCGCAGAAGAAGCTAAAGCAATGGACAGAAGAAAAATATGCATACAGATATGATGAGACCAGGCAAACGTTG
TTCATCGTACCGAAGAATAACTCTCCTGGGACGAAACATGCTGTGAGGGTTAGGGTGTGGCCGCCTATCAGACCG
GTGATGAATTTGAATAGTTTCTGGAGTGATTTTGGTGTAGGAGTCGTTACTGTTGGTCTTCTACTTGCTGTGTTG
CTCGCTGCGGCGGCGATGGCTATGGGTACTGTTTGGTTGGGCTATACATGA
Gene >Agabi119p4|711350
ATGTTCAATCTCCAGTCCACCGATGGTTCTTATATTCTTGTGGACGACGCTGTACGCGTAAGTTGTTTCCTTGAA
GTGTTTTCACTTGTTTCTTAACCCCCATATTCCCAGAAACACCCCTCAAAGGGATCTCAGTACAAGCCAGGCTCT
GTAACATCATACGCCCACGATTGGTCTCCATTGAGTACAGGTGGTGGGATTCGTCTAAAAGGACGAGATTTCGTT
GATGGATACGGTCGTGTTTGTAACCTTCGTGGTGTTAATCTTTCAGGAAACTGTAAAATGTGGGTCCATCTTTAT
TCCTATTCGGCTTTTCTCCTTATCCTCTTAGTCCCGTCAACCATTCGATCGAGGAATTTCCTGATGACCCAAAGG
CTGTGACTTTTATCGGACATCCCTTTCCACTGTCTGAGGCCCATGAGCACTTCTCTAGGTTGAGGAAGTGGGGCT
TAACATTCAGTGCGTGTCTTTTTATGCCGTGATTTAACAAAGATTCCATTTCTACTATAGTTCGTTTTATTGTGA
CATGGGAGGCTATAGAACACCAAGGGCCGTACGTAATTCCAGACCACTTATTTCCAAATTTTCAGCTAAATGTCA
TAGTGGAATATATGACCAAGAATACCTAACGTATCTTCGCGAATTACTATCACTCCTGCCGAAATATGGTCTTAT
AGCATACGTTTCTCTTCACCAAGATGTCTGGTCTCGGTACACTGGCGGTTCTGGTGCACCAGCGTGGACAGTTGA
AGCTGCTGGCTTCGATCTGAACGCACTGGAAGAAACTGGCGCCGCCTGGTTGGGGGGGATGCGCGGAGGCGGTCA
CGATGAAACAGAAAAAGGACTATGGCCGACTGGATATCACAAGCTTGCCGCGTCGACAATGAAGTAAATATTTGA
CTCCTCTGATACAGAATGTTGCTGATATATGTGGTATAGTACCCTGTTTTGGGGTGGTGATACCTTTGCTCCCAA
ACTGAAGACTGAAGATGGTACTTCCATTCAGCAATTCCTTCAAGACGCGTTTTTGAACGCGTGGGATGCTCTTGT
GAATGCAGTGGGTAACCTTGAGGGTGTTATCGGTTTTCAGATGATGAATGAACCTCACAGAGGTTACATTGCCCT
CAAGTCAATGTATTCCTTTGATTACAACACCGAACTTCACCTCTCTCATATTCCCTCAACCATTGAGTCCTTCCA
GCTGGGTGCTGGGCACCCGACGCTCGTACGAGGCTGGACTCGCTCGTGGCCCATGCCGTCGAGGCAGACAAAACA
AACGATACTGAACGAAGGAAAGAAGAGGGCGTGGAAGGAAGATGGACCGACTAAGGGACAGTGTTTGTGGGAGAT
GCACGGTGTTTGGGGATGGTGTAAAACCAAAAACCAGGCAGTTGTGTTGAGGGAGAATTATTTCCTCAAGCATCC
GGTCAGCGGAAAGAAGGTTGGGACCATACATACAGCTGCTAGGTTTCACTCAGACTGATTTGGCACAGGTCGATT
GGTACACCGACCATTACTATCCCTTTCTGAAAAATTGGGCGGATAGAGTGCTGAGAGCGACGTCTTCGAGCAAAT
TCTTGTTCGTTGAACCTATACCCAATGAGGTACACTTTCTTTCGCCATACACGCTTCATTTTCAATTACATTGTT
ATAGTATTGCCCTCCTTCCTGGACAGAACACCGCCTTCCCAACATGGTGTATGCGCCACATTGGTACGACTTGTA
CTCACTATTCAACAAGTCCTTTGGCGAATTCTCTGTTAATGTTCAAGGCCTGTCGCGGGTAAGTCGTCACTTACT
CCACTCTTGTCCTTTTGGTCATCAATAGCACAGGGAATGTTCCCTTTGAAAGCTTTCTACTGGGGTCACGTCGGT
GCTCGGAACAACTATAGTCTTCAAATTCGTAATCTGAAAGAAGAAGCATATAAATCTCTGGGCAATGTACCCGTG
ATATTCGGAGAATGTGGTATACCTATGGATATGAAGTAAGAATCAGATTCATATGACTATGTTCCTTGTTGACGT
CGTTCTCTACATTATAGCCAAGGAATAGCCTTTACGACGGAGGAATTTCTTTGGCAGAGACGGATGATGGATGCT
ATGATCACCGGCTTCGATCGGTCATCAGTCGGGTTCAAGTACGCTCGCTTCTCATTCCCTATCAAAGTGTTCTGA
CTCGTTTGTTATAGCTTGTGGAACTACAACCCCGATAACACCGACGAACACGGTGATAAGTGGAATGGCGAAAAT
TTTTCTTGGTTTTCTCAGCGCCGTGCAATGCCCAACTTTTTACTCGAATACGAACAAAACACTCCTCATCTCGAT
GGTGGTGGTCGTATCCTCGATGCAATCGTCCGACCATATCCTGCAAAAGTAGCGGGTACACCGCTCGATTTCAGT
TATGAGATGATGAATGGAGAATTTACGTTCTCGTGGATGGTACCTCTTCAAGGCGTCAGAGATGAAAACGAATTA
GGATCTTACGAAACTGAAATCTTCTTACCTTCACAACTCGCGTCCGGCAGAAAAGTGCTCGTGGAAACTGATGTT
GATTGGAGAAAACATGACATTGATGATGGAGTCGCAGCGCAGAAGAAGCTAAAGCAATGGACAGAAGAAAAATAT
GCATACAGATATGATGAGACCAGGCAAACGTTGTTCATCGTACCGAAGAATAACTCTCCTGGGACGAAACATGCT
GTGAGGGTTAGGGTGTGGCCGCCTATCAGACCGGTGATGAATTTGAATAGTTTCTGGAGTGATTTTGGTGTAGGA
GTCGTTACTGTTGGTCTTCTACTTGCTGTGTTGCTCGCTGCGGCGGCGATGGCTATGGGTACTGTTTGGTTGGGC
TATACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail