Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|709250
Gene name
Locationscaffold_09:202559..205637
Strand-
Gene length (bp)3078
Transcript length (bp)3078
Coding sequence length (bp)3078
Protein length (aa) 1026

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 4.7E-34 332 437
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 9.8E-31 306 406
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 7.1E-24 82 243
PF17921 Integrase_H2C2 Integrase zinc binding domain 3.5E-20 548 606
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 3.1E-13 920 969

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 2 902 8.0E-160
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 2 902 8.0E-160
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 2 902 8.0E-160
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 2 902 8.0E-160
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 2 902 9.0E-160
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 2 902 8.0E-160
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 2 902 8.0E-160
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 2 902 8.0E-160
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 2 902 8.0E-160
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 2 902 9.0E-160
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 2 902 9.0E-160
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 2 902 9.0E-160
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 2 902 9.0E-160
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 2 902 2.0E-159
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 2 902 2.0E-159
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 2 902 2.0E-159
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 26 914 4.0E-143
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 26 891 4.0E-142
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 39 847 4.0E-89
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 38 781 4.0E-84
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 16 655 2.0E-77
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 17 655 7.0E-76
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 17 457 2.0E-59
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 30 457 5.0E-48
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 30 457 5.0E-48
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 30 457 9.0E-48
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 30 457 3.0E-47
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 30 457 2.0E-46
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 30 457 2.0E-44
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 19 455 1.0E-43
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 54 457 1.0E-38
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 46 457 2.0E-33
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 37 391 2.0E-31
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 39 391 3.0E-31
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 47 461 4.0E-31
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 38 499 5.0E-31
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 46 457 1.0E-30
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 35 470 5.0E-30
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 47 452 6.0E-30
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 35 470 7.0E-30
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 30 468 2.0E-29
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 37 391 3.0E-29
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 31 474 3.0E-29
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 37 377 3.0E-28
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 2 447 3.0E-28
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 31 370 3.0E-27
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 31 370 1.0E-26
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 31 370 1.0E-26
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 31 370 1.0E-26
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 31 370 1.0E-26
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 31 370 2.0E-26
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 31 370 2.0E-26
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 31 370 3.0E-26
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 31 370 5.0E-26
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 30 474 5.0E-26
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 555 877 1.0E-25
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 31 370 1.0E-25
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 3 474 6.0E-25
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 84 458 3.0E-24
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 417 783 9.0E-24
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 552 783 5.0E-23
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 530 783 1.0E-22
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 538 783 3.0E-22
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 552 776 5.0E-22
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 46 524 1.0E-20
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 528 836 2.0E-19
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 77 285 6.0E-18
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 539 878 2.0E-17
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 536 779 2.0E-17
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 90 185 6.0E-17
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 536 779 6.0E-17
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 516 779 1.0E-16
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 213 332 1.0E-15
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 539 878 4.0E-15
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 556 779 6.0E-15
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 522 878 7.0E-15
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 588 878 1.0E-14
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 588 878 1.0E-14
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 536 779 1.0E-14
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 522 878 1.0E-14
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 629 878 1.0E-14
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 538 876 3.0E-14
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 45 302 4.0E-14
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 522 878 7.0E-14
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 522 878 1.0E-13
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 12 297 1.0E-13
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 45 301 2.0E-13
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 45 301 2.0E-13
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 12 297 3.0E-13
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 588 878 4.0E-13
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 45 302 6.0E-13
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 12 297 1.0E-12
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 536 779 1.0E-12
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 572 878 2.0E-12
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 552 878 2.0E-12
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 45 302 2.0E-12
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 588 878 6.0E-12
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 588 878 6.0E-12
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 45 281 1.0E-11
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 555 936 3.0E-11
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 45 302 3.0E-11
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 19 275 3.0E-11
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 45 281 3.0E-11
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 45 281 4.0E-11
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 45 305 4.0E-11
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 531 733 5.0E-11
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 45 281 8.0E-11
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 45 281 1.0E-10
sp|P03361|POL_BLVJ Pol polyprotein OS=Bovine leukemia virus (isolate Japanese BLV-1) GN=pol PE=3 SV=1 42 275 1.0E-10
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 490 776 2.0E-10
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 18 279 3.0E-10
sp|G3V8T1|MPP8_RAT M-phase phosphoprotein 8 OS=Rattus norvegicus GN=Mphosph8 PE=2 SV=1 870 983 3.0E-10
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 45 281 4.0E-10
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 45 281 4.0E-10
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 16 258 7.0E-10
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 18 279 8.0E-10
sp|Q3TYA6|MPP8_MOUSE M-phase phosphoprotein 8 OS=Mus musculus GN=Mphosph8 PE=1 SV=1 870 983 8.0E-10
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 45 301 9.0E-10
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 45 281 1.0E-09
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey sarcoma virus GN=pol PE=3 SV=1 629 878 2.0E-09
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 18 279 2.0E-09
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal a-particle MIA14 GN=pol PE=3 SV=1 47 294 2.0E-09
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 45 281 2.0E-09
sp|P05962|POL_HV2NZ Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 18 279 2.0E-09
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 18 279 3.0E-09
sp|Q89928|POL_HV2EH Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) GN=gag-pol PE=3 SV=3 45 279 3.0E-09
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 18 279 5.0E-09
sp|P25059|POL_BLVAU Pol polyprotein OS=Bovine leukemia virus (isolate Australian) GN=pol PE=3 SV=1 42 275 7.0E-09
sp|Q99549|MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens GN=MPHOSPH8 PE=1 SV=2 903 983 8.0E-09
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 16 251 1.0E-08
sp|Q76634|POL_HV2UC Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate UC1) GN=gag-pol PE=3 SV=3 31 283 2.0E-08
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 31 283 2.0E-08
sp|P12502|POL_SIVS4 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate F236/smH4) GN=gag-pol PE=3 SV=2 18 279 3.0E-08
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 18 279 3.0E-08
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 490 780 7.0E-08
sp|Q9Y232|CDYL1_HUMAN Chromodomain Y-like protein OS=Homo sapiens GN=CDYL PE=1 SV=2 893 973 8.0E-08
sp|P05897|POL_SIVMK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate K6W) GN=gag-pol PE=1 SV=2 18 279 8.0E-08
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 264 376 1.0E-07
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 45 238 1.0E-07
sp|Q6AYK9|CDYL_RAT Chromodomain Y-like protein OS=Rattus norvegicus GN=Cdyl PE=1 SV=1 909 973 1.0E-07
sp|Q9WTK2|CDYL_MOUSE Chromodomain Y-like protein OS=Mus musculus GN=Cdyl PE=1 SV=1 909 973 2.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 45 217 4.0E-07
sp|P63128|POK9_HUMAN Endogenous retrovirus group K member 9 Pol protein OS=Homo sapiens GN=ERVK-9 PE=3 SV=3 45 183 7.0E-07
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 31 283 1.0E-06
sp|P11204|POL_EIAV9 Pol polyprotein OS=Equine infectious anemia virus (isolate 1369) GN=pol PE=1 SV=1 31 314 1.0E-06
sp|P32542|POL_EIAVC Pol polyprotein OS=Equine infectious anemia virus (isolate CL22) GN=pol PE=1 SV=1 31 314 2.0E-06
sp|Q61686|CBX5_MOUSE Chromobox protein homolog 5 OS=Mus musculus GN=Cbx5 PE=1 SV=1 922 974 2.0E-06
sp|P45973|CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens GN=CBX5 PE=1 SV=1 922 974 3.0E-06
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 31 285 3.0E-06
sp|Q79666|POL_HV1MV Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag-pol PE=3 SV=3 31 285 4.0E-06
sp|Q9Y6F7|CDY2_HUMAN Testis-specific chromodomain protein Y 2 OS=Homo sapiens GN=CDY2A PE=1 SV=1 916 969 4.0E-06
sp|Q9Y6F8|CDY1_HUMAN Testis-specific chromodomain protein Y 1 OS=Homo sapiens GN=CDY1 PE=1 SV=1 916 969 4.0E-06
sp|Q8N8U2|CDYL2_HUMAN Chromodomain Y-like protein 2 OS=Homo sapiens GN=CDYL2 PE=1 SV=2 920 984 6.0E-06
sp|P35956|POL_VILVK Pol polyprotein OS=Maedi visna virus (strain KV1772) GN=pol PE=1 SV=1 12 286 6.0E-06
sp|O91080|POL_HV1YF Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag-pol PE=3 SV=3 31 299 6.0E-06
sp|P03370|POL_VILV Pol polyprotein OS=Maedi visna virus (strain 1514) GN=pol PE=3 SV=1 12 286 7.0E-06
sp|P23427|POL_VILV2 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS2) GN=pol PE=3 SV=1 12 286 7.0E-06
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 31 298 7.0E-06
sp|Q9D5D8|CDYL2_MOUSE Chromodomain Y-like protein 2 OS=Mus musculus GN=Cdyl2 PE=1 SV=1 920 971 7.0E-06
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 31 298 9.0E-06
sp|P03371|POL_EIAVY Pol polyprotein OS=Equine infectious anemia virus (strain Wyoming) GN=pol PE=3 SV=1 31 314 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|709250
MVPKRFHKFLKVFKQKESERMPTRKPWDHAIELKEGFKPKKGKIYPLSPNEREEVQAFVKDQLRKGYIRPSKSPQ
TSPVFFVPKKDGKKRMVQDYRFLNDWTIKNNYPLPLISELIDTMGSKRLFSKIDLRWGYNNIRIKEGDEWKAAFT
TFMGAFEPTVMFVGLTNSPATFQTMMNELFRDLVNTGKVAVFIDDILIGTDDEEEHDKVVEEVLQRLMDNDLFAK
PEKCEWKRSEMGFLGCIIGRNGIKMEERKVKDVVEWPTPKCVKDVQRFLGLANYYRRFIEKFASIAKPLHALTKK
DKKWSWGDEEEEAFGALKTKFTSHPILVAPELDKELKVESDASAYATGGELSMKCEDGKWRPVAYISKSMTETER
NYDIHDREMLGIMRCLEEWRHFLEGAKHKFEIWTDHRNLEYFAKAQQLNRRQARWALYLSRFNFELKFRPGKTMG
KADALSRRPDFEQGTKDDNKDQTLLKPEYFAIRAMEEGHMLINAEEGEILDEIRKSEAKEDDVIKAVKRAKVKSL
RGDEWKLEDGLVLKEGKVYVPKDETLRTKIIRLHHDTPIAGHGGQWKTVEMVTRNYWWPGVTKQVQKYVEGCDQC
QRNKNRPTPPAGKLMPNPIPTKPWADVSVDFIVKLPESQGMDSILVVCDRFSKMAHFIPTTETTSALGLAKLFRD
HVWKLHGLPETVISDRGPQFAADFTKELNKMLGIDTRLSTAFHPQTDGQTERTNQELEQYLRSFVDHRQTDWPDW
LATAEFSYNNKEQSSTKETPFMVNVGRHPRTGFDLRRQGNHPAAADFADRMKLQHEETQAALKKAQDDMRRYADR
DRGEAVKYKVGDKILLATRDLQIQGRPTRKLTEKFIGPYTVKKIISPNAVELDLPRSIRIHPVVNVSRIVMYREQ
VEGQGSKPAPAVEIEGEQEWEVEKILNAKWFRGKKRYLVRWKGYTAEADSWEPEENLANAKELITEFHQLYGELN
RIHHVLRDTGFQERELPNQFTAKALVGWDDKQFDAEYLKKLERNWRTWRS*
Coding >Agabi119p4|709250
ATGGTGCCAAAACGGTTCCACAAATTCCTTAAAGTGTTCAAACAGAAGGAGTCGGAAAGGATGCCTACTAGAAAA
CCGTGGGATCATGCTATCGAATTGAAGGAGGGTTTCAAACCCAAGAAAGGAAAAATATACCCCTTGTCACCAAAC
GAAAGAGAAGAGGTCCAAGCATTCGTCAAGGACCAACTTCGAAAGGGATATATCAGGCCATCGAAATCCCCTCAA
ACTTCGCCGGTATTTTTTGTGCCAAAGAAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGAC
TGGACAATTAAGAACAATTACCCTTTACCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACGATTATTT
TCTAAGATAGATTTACGTTGGGGTTATAATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACT
ACTTTCATGGGTGCCTTCGAACCAACTGTTATGTTTGTTGGACTTACAAATTCGCCTGCTACTTTTCAGACTATG
ATGAACGAACTTTTTAGGGACTTAGTAAATACCGGGAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACG
GACGACGAAGAGGAGCACGATAAGGTGGTAGAAGAAGTATTGCAGAGGTTGATGGACAACGATCTATTCGCAAAG
CCAGAAAAATGCGAATGGAAGCGAAGCGAAATGGGATTCTTAGGGTGTATAATAGGGAGGAATGGAATCAAGATG
GAGGAAAGGAAGGTGAAGGACGTAGTAGAATGGCCAACCCCAAAATGCGTTAAAGATGTACAAAGGTTCTTGGGA
CTAGCAAACTATTATCGACGGTTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAG
GACAAGAAATGGAGTTGGGGAGATGAAGAAGAAGAAGCCTTTGGTGCGTTAAAAACAAAATTCACATCACATCCA
ATCCTAGTAGCACCAGAATTGGACAAAGAACTAAAGGTAGAATCGGACGCATCAGCTTATGCCACGGGCGGAGAA
TTGTCGATGAAATGTGAAGATGGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACAGAGACTGAACGA
AATTACGATATTCACGATAGAGAGATGTTGGGAATAATGCGATGTTTAGAAGAATGGAGACACTTCCTGGAAGGG
GCAAAGCATAAATTCGAAATTTGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAACCGA
CGACAAGCGAGATGGGCTTTGTACTTGTCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGG
AAGGCAGACGCATTGAGCAGAAGACCTGACTTCGAACAAGGAACCAAGGACGATAACAAGGATCAAACTTTGTTA
AAACCAGAATATTTTGCAATTCGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAAGAAGGAGAGATATTA
GATGAAATCCGAAAATCAGAAGCAAAAGAGGACGATGTAATAAAAGCGGTGAAGCGAGCAAAGGTAAAGTCGTTG
AGAGGAGACGAATGGAAACTGGAAGATGGGCTAGTATTGAAAGAAGGAAAAGTCTATGTGCCAAAAGACGAGACA
CTAAGGACGAAAATCATTCGACTACATCACGATACTCCCATTGCCGGACATGGAGGACAATGGAAAACAGTCGAA
ATGGTAACACGCAATTACTGGTGGCCTGGCGTAACTAAGCAAGTTCAGAAGTACGTAGAAGGATGCGACCAATGT
CAACGGAATAAGAACCGACCAACACCACCGGCAGGAAAATTAATGCCAAACCCCATTCCCACGAAACCCTGGGCC
GACGTATCCGTCGACTTTATAGTGAAATTACCAGAATCTCAGGGAATGGACTCAATCTTGGTGGTATGCGATCGT
TTTAGTAAAATGGCTCATTTTATTCCAACTACGGAAACAACGTCGGCACTAGGATTAGCCAAGCTGTTCAGGGAT
CATGTGTGGAAGTTGCATGGATTACCAGAAACGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGACTTCACA
AAGGAGTTGAACAAAATGTTGGGAATCGATACCCGGTTATCTACGGCGTTCCACCCACAGACCGATGGGCAAACC
GAGCGAACCAATCAAGAACTGGAACAATATCTCCGATCATTTGTCGACCACAGACAAACTGATTGGCCTGATTGG
TTGGCAACGGCGGAGTTTTCCTACAACAATAAAGAACAATCATCGACAAAAGAAACTCCATTTATGGTCAATGTG
GGAAGGCACCCTAGAACTGGCTTCGATCTTCGACGACAAGGAAATCACCCGGCAGCAGCAGACTTTGCAGACCGC
ATGAAACTTCAACACGAAGAAACTCAAGCGGCCCTGAAGAAGGCACAAGACGACATGCGGAGGTATGCGGATAGA
GACAGAGGAGAAGCGGTGAAATACAAAGTGGGAGATAAAATTCTATTGGCTACCCGGGACCTTCAAATCCAAGGA
CGACCAACTCGAAAACTTACGGAGAAGTTCATCGGGCCGTACACTGTCAAGAAGATCATTTCCCCCAACGCAGTG
GAATTAGATCTTCCCCGATCTATTCGGATCCATCCGGTGGTTAACGTCAGCCGAATAGTAATGTACCGAGAACAA
GTGGAAGGCCAAGGAAGCAAGCCGGCACCAGCCGTAGAAATAGAAGGAGAACAGGAGTGGGAAGTAGAGAAGATC
CTGAATGCCAAATGGTTCCGTGGAAAGAAGCGGTACTTAGTTCGATGGAAAGGATATACGGCAGAAGCAGATTCG
TGGGAACCCGAAGAGAATTTGGCTAACGCCAAAGAATTGATTACTGAATTCCACCAACTCTATGGGGAACTCAAT
AGGATACATCACGTTTTACGTGACACAGGTTTCCAAGAAAGGGAACTACCTAATCAATTCACAGCCAAGGCTTTA
GTTGGGTGGGACGACAAACAATTTGACGCCGAATATCTTAAGAAGTTGGAACGAAATTGGCGGACTTGGAGGTCT
TGA
Transcript >Agabi119p4|709250
ATGGTGCCAAAACGGTTCCACAAATTCCTTAAAGTGTTCAAACAGAAGGAGTCGGAAAGGATGCCTACTAGAAAA
CCGTGGGATCATGCTATCGAATTGAAGGAGGGTTTCAAACCCAAGAAAGGAAAAATATACCCCTTGTCACCAAAC
GAAAGAGAAGAGGTCCAAGCATTCGTCAAGGACCAACTTCGAAAGGGATATATCAGGCCATCGAAATCCCCTCAA
ACTTCGCCGGTATTTTTTGTGCCAAAGAAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGAC
TGGACAATTAAGAACAATTACCCTTTACCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACGATTATTT
TCTAAGATAGATTTACGTTGGGGTTATAATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACT
ACTTTCATGGGTGCCTTCGAACCAACTGTTATGTTTGTTGGACTTACAAATTCGCCTGCTACTTTTCAGACTATG
ATGAACGAACTTTTTAGGGACTTAGTAAATACCGGGAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACG
GACGACGAAGAGGAGCACGATAAGGTGGTAGAAGAAGTATTGCAGAGGTTGATGGACAACGATCTATTCGCAAAG
CCAGAAAAATGCGAATGGAAGCGAAGCGAAATGGGATTCTTAGGGTGTATAATAGGGAGGAATGGAATCAAGATG
GAGGAAAGGAAGGTGAAGGACGTAGTAGAATGGCCAACCCCAAAATGCGTTAAAGATGTACAAAGGTTCTTGGGA
CTAGCAAACTATTATCGACGGTTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAG
GACAAGAAATGGAGTTGGGGAGATGAAGAAGAAGAAGCCTTTGGTGCGTTAAAAACAAAATTCACATCACATCCA
ATCCTAGTAGCACCAGAATTGGACAAAGAACTAAAGGTAGAATCGGACGCATCAGCTTATGCCACGGGCGGAGAA
TTGTCGATGAAATGTGAAGATGGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACAGAGACTGAACGA
AATTACGATATTCACGATAGAGAGATGTTGGGAATAATGCGATGTTTAGAAGAATGGAGACACTTCCTGGAAGGG
GCAAAGCATAAATTCGAAATTTGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAACCGA
CGACAAGCGAGATGGGCTTTGTACTTGTCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGG
AAGGCAGACGCATTGAGCAGAAGACCTGACTTCGAACAAGGAACCAAGGACGATAACAAGGATCAAACTTTGTTA
AAACCAGAATATTTTGCAATTCGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAAGAAGGAGAGATATTA
GATGAAATCCGAAAATCAGAAGCAAAAGAGGACGATGTAATAAAAGCGGTGAAGCGAGCAAAGGTAAAGTCGTTG
AGAGGAGACGAATGGAAACTGGAAGATGGGCTAGTATTGAAAGAAGGAAAAGTCTATGTGCCAAAAGACGAGACA
CTAAGGACGAAAATCATTCGACTACATCACGATACTCCCATTGCCGGACATGGAGGACAATGGAAAACAGTCGAA
ATGGTAACACGCAATTACTGGTGGCCTGGCGTAACTAAGCAAGTTCAGAAGTACGTAGAAGGATGCGACCAATGT
CAACGGAATAAGAACCGACCAACACCACCGGCAGGAAAATTAATGCCAAACCCCATTCCCACGAAACCCTGGGCC
GACGTATCCGTCGACTTTATAGTGAAATTACCAGAATCTCAGGGAATGGACTCAATCTTGGTGGTATGCGATCGT
TTTAGTAAAATGGCTCATTTTATTCCAACTACGGAAACAACGTCGGCACTAGGATTAGCCAAGCTGTTCAGGGAT
CATGTGTGGAAGTTGCATGGATTACCAGAAACGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGACTTCACA
AAGGAGTTGAACAAAATGTTGGGAATCGATACCCGGTTATCTACGGCGTTCCACCCACAGACCGATGGGCAAACC
GAGCGAACCAATCAAGAACTGGAACAATATCTCCGATCATTTGTCGACCACAGACAAACTGATTGGCCTGATTGG
TTGGCAACGGCGGAGTTTTCCTACAACAATAAAGAACAATCATCGACAAAAGAAACTCCATTTATGGTCAATGTG
GGAAGGCACCCTAGAACTGGCTTCGATCTTCGACGACAAGGAAATCACCCGGCAGCAGCAGACTTTGCAGACCGC
ATGAAACTTCAACACGAAGAAACTCAAGCGGCCCTGAAGAAGGCACAAGACGACATGCGGAGGTATGCGGATAGA
GACAGAGGAGAAGCGGTGAAATACAAAGTGGGAGATAAAATTCTATTGGCTACCCGGGACCTTCAAATCCAAGGA
CGACCAACTCGAAAACTTACGGAGAAGTTCATCGGGCCGTACACTGTCAAGAAGATCATTTCCCCCAACGCAGTG
GAATTAGATCTTCCCCGATCTATTCGGATCCATCCGGTGGTTAACGTCAGCCGAATAGTAATGTACCGAGAACAA
GTGGAAGGCCAAGGAAGCAAGCCGGCACCAGCCGTAGAAATAGAAGGAGAACAGGAGTGGGAAGTAGAGAAGATC
CTGAATGCCAAATGGTTCCGTGGAAAGAAGCGGTACTTAGTTCGATGGAAAGGATATACGGCAGAAGCAGATTCG
TGGGAACCCGAAGAGAATTTGGCTAACGCCAAAGAATTGATTACTGAATTCCACCAACTCTATGGGGAACTCAAT
AGGATACATCACGTTTTACGTGACACAGGTTTCCAAGAAAGGGAACTACCTAATCAATTCACAGCCAAGGCTTTA
GTTGGGTGGGACGACAAACAATTTGACGCCGAATATCTTAAGAAGTTGGAACGAAATTGGCGGACTTGGAGGTCT
TGA
Gene >Agabi119p4|709250
ATGGTGCCAAAACGGTTCCACAAATTCCTTAAAGTGTTCAAACAGAAGGAGTCGGAAAGGATGCCTACTAGAAAA
CCGTGGGATCATGCTATCGAATTGAAGGAGGGTTTCAAACCCAAGAAAGGAAAAATATACCCCTTGTCACCAAAC
GAAAGAGAAGAGGTCCAAGCATTCGTCAAGGACCAACTTCGAAAGGGATATATCAGGCCATCGAAATCCCCTCAA
ACTTCGCCGGTATTTTTTGTGCCAAAGAAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGAC
TGGACAATTAAGAACAATTACCCTTTACCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACGATTATTT
TCTAAGATAGATTTACGTTGGGGTTATAATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACT
ACTTTCATGGGTGCCTTCGAACCAACTGTTATGTTTGTTGGACTTACAAATTCGCCTGCTACTTTTCAGACTATG
ATGAACGAACTTTTTAGGGACTTAGTAAATACCGGGAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACG
GACGACGAAGAGGAGCACGATAAGGTGGTAGAAGAAGTATTGCAGAGGTTGATGGACAACGATCTATTCGCAAAG
CCAGAAAAATGCGAATGGAAGCGAAGCGAAATGGGATTCTTAGGGTGTATAATAGGGAGGAATGGAATCAAGATG
GAGGAAAGGAAGGTGAAGGACGTAGTAGAATGGCCAACCCCAAAATGCGTTAAAGATGTACAAAGGTTCTTGGGA
CTAGCAAACTATTATCGACGGTTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAG
GACAAGAAATGGAGTTGGGGAGATGAAGAAGAAGAAGCCTTTGGTGCGTTAAAAACAAAATTCACATCACATCCA
ATCCTAGTAGCACCAGAATTGGACAAAGAACTAAAGGTAGAATCGGACGCATCAGCTTATGCCACGGGCGGAGAA
TTGTCGATGAAATGTGAAGATGGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACAGAGACTGAACGA
AATTACGATATTCACGATAGAGAGATGTTGGGAATAATGCGATGTTTAGAAGAATGGAGACACTTCCTGGAAGGG
GCAAAGCATAAATTCGAAATTTGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAACCGA
CGACAAGCGAGATGGGCTTTGTACTTGTCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGG
AAGGCAGACGCATTGAGCAGAAGACCTGACTTCGAACAAGGAACCAAGGACGATAACAAGGATCAAACTTTGTTA
AAACCAGAATATTTTGCAATTCGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAAGAAGGAGAGATATTA
GATGAAATCCGAAAATCAGAAGCAAAAGAGGACGATGTAATAAAAGCGGTGAAGCGAGCAAAGGTAAAGTCGTTG
AGAGGAGACGAATGGAAACTGGAAGATGGGCTAGTATTGAAAGAAGGAAAAGTCTATGTGCCAAAAGACGAGACA
CTAAGGACGAAAATCATTCGACTACATCACGATACTCCCATTGCCGGACATGGAGGACAATGGAAAACAGTCGAA
ATGGTAACACGCAATTACTGGTGGCCTGGCGTAACTAAGCAAGTTCAGAAGTACGTAGAAGGATGCGACCAATGT
CAACGGAATAAGAACCGACCAACACCACCGGCAGGAAAATTAATGCCAAACCCCATTCCCACGAAACCCTGGGCC
GACGTATCCGTCGACTTTATAGTGAAATTACCAGAATCTCAGGGAATGGACTCAATCTTGGTGGTATGCGATCGT
TTTAGTAAAATGGCTCATTTTATTCCAACTACGGAAACAACGTCGGCACTAGGATTAGCCAAGCTGTTCAGGGAT
CATGTGTGGAAGTTGCATGGATTACCAGAAACGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGACTTCACA
AAGGAGTTGAACAAAATGTTGGGAATCGATACCCGGTTATCTACGGCGTTCCACCCACAGACCGATGGGCAAACC
GAGCGAACCAATCAAGAACTGGAACAATATCTCCGATCATTTGTCGACCACAGACAAACTGATTGGCCTGATTGG
TTGGCAACGGCGGAGTTTTCCTACAACAATAAAGAACAATCATCGACAAAAGAAACTCCATTTATGGTCAATGTG
GGAAGGCACCCTAGAACTGGCTTCGATCTTCGACGACAAGGAAATCACCCGGCAGCAGCAGACTTTGCAGACCGC
ATGAAACTTCAACACGAAGAAACTCAAGCGGCCCTGAAGAAGGCACAAGACGACATGCGGAGGTATGCGGATAGA
GACAGAGGAGAAGCGGTGAAATACAAAGTGGGAGATAAAATTCTATTGGCTACCCGGGACCTTCAAATCCAAGGA
CGACCAACTCGAAAACTTACGGAGAAGTTCATCGGGCCGTACACTGTCAAGAAGATCATTTCCCCCAACGCAGTG
GAATTAGATCTTCCCCGATCTATTCGGATCCATCCGGTGGTTAACGTCAGCCGAATAGTAATGTACCGAGAACAA
GTGGAAGGCCAAGGAAGCAAGCCGGCACCAGCCGTAGAAATAGAAGGAGAACAGGAGTGGGAAGTAGAGAAGATC
CTGAATGCCAAATGGTTCCGTGGAAAGAAGCGGTACTTAGTTCGATGGAAAGGATATACGGCAGAAGCAGATTCG
TGGGAACCCGAAGAGAATTTGGCTAACGCCAAAGAATTGATTACTGAATTCCACCAACTCTATGGGGAACTCAAT
AGGATACATCACGTTTTACGTGACACAGGTTTCCAAGAAAGGGAACTACCTAATCAATTCACAGCCAAGGCTTTA
GTTGGGTGGGACGACAAACAATTTGACGCCGAATATCTTAAGAAGTTGGAACGAAATTGGCGGACTTGGAGGTCT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail