Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|709050
Gene name
Locationscaffold_09:196473..197292
Strand-
Gene length (bp)819
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 1.7E-20 3 74
PF17921 Integrase_H2C2 Integrase zinc binding domain 1.6E-19 195 249
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.2E-09 2 40

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 3 259 4.0E-28
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 3 259 5.0E-28
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 3 259 5.0E-28
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 3 259 5.0E-28
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 3 259 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 3 259 4.0E-28
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 3 259 5.0E-28
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 3 259 5.0E-28
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 3 259 5.0E-28
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 3 259 5.0E-28
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 3 259 5.0E-28
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 3 259 5.0E-28
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 3 259 5.0E-28
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 3 259 5.0E-28
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 3 259 5.0E-28
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 3 259 5.0E-28
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 3 251 5.0E-17
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 3 251 6.0E-17
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 2 253 5.0E-11
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 4 259 2.0E-10
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 2 259 7.0E-09
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 4 94 3.0E-08
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 4 92 7.0E-08
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 4 96 1.0E-06
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 174 244 2.0E-06
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 174 244 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|709050
MLFSKSFSDAERKYDIHDRELLAIKRAFEEWRHYLEGATHKVLVRSDHRNLTFWKKPQKINHRQARWYEFLTRFD
FVIEHVPGEKIPAADALSRQPDHTPPGSLEDERVTLLDEDRFIAEITILDQAKFVNVIDLDLQTDIIDAMRNDNP
MHEIVQDVIKKKPELIKDNYSLYDTEGGTLLLRDGRVIIPDNVDAKRKILQRYHDHPTSGHPGEQETYRRVKQVA
YWPGMSTFVRNYVKGCAMCQQNKINRHPSNPPLRRLIHLVLLDLSPI*
Coding >Agabi119p4|709050
ATGTTGTTCTCAAAGTCTTTTAGTGATGCTGAGAGGAAATATGATATACATGACCGTGAACTATTAGCAATCAAA
CGAGCTTTCGAGGAATGGAGACACTATCTGGAAGGAGCTACTCATAAAGTTCTAGTCCGTTCAGATCATCGAAAC
CTGACATTCTGGAAGAAACCACAAAAGATCAACCACCGTCAAGCTCGATGGTATGAATTTTTGACCCGCTTTGAT
TTCGTTATAGAACATGTTCCTGGCGAAAAGATTCCGGCAGCAGACGCTTTGTCTAGACAACCCGATCACACCCCA
CCTGGATCATTAGAGGATGAACGAGTGACTCTCCTCGATGAAGATAGGTTCATTGCCGAAATCACTATCTTAGAC
CAAGCCAAATTCGTCAATGTCATTGACCTAGACTTGCAAACTGACATCATCGATGCTATGAGAAATGACAATCCG
ATGCATGAAATCGTACAAGATGTTATCAAAAAGAAACCAGAGTTGATCAAAGACAATTATTCCTTGTACGATACT
GAAGGCGGAACACTTCTTTTGAGGGATGGACGTGTCATTATTCCGGACAATGTTGACGCCAAACGCAAAATCTTG
CAACGCTATCATGATCATCCTACTAGTGGACACCCAGGTGAACAGGAAACCTATCGACGAGTTAAACAAGTCGCT
TACTGGCCTGGAATGTCTACATTTGTCCGAAACTACGTTAAAGGCTGTGCAATGTGTCAACAGAACAAGATTAAC
CGCCATCCGTCTAATCCCCCGCTACGCCGATTGATCCACCTGGTTCTATTAGACCTTTCTCCCATATAG
Transcript >Agabi119p4|709050
ATGTTGTTCTCAAAGTCTTTTAGTGATGCTGAGAGGAAATATGATATACATGACCGTGAACTATTAGCAATCAAA
CGAGCTTTCGAGGAATGGAGACACTATCTGGAAGGAGCTACTCATAAAGTTCTAGTCCGTTCAGATCATCGAAAC
CTGACATTCTGGAAGAAACCACAAAAGATCAACCACCGTCAAGCTCGATGGTATGAATTTTTGACCCGCTTTGAT
TTCGTTATAGAACATGTTCCTGGCGAAAAGATTCCGGCAGCAGACGCTTTGTCTAGACAACCCGATCACACCCCA
CCTGGATCATTAGAGGATGAACGAGTGACTCTCCTCGATGAAGATAGGTTCATTGCCGAAATCACTATCTTAGAC
CAAGCCAAATTCGTCAATGTCATTGACCTAGACTTGCAAACTGACATCATCGATGCTATGAGAAATGACAATCCG
ATGCATGAAATCGTACAAGATGTTATCAAAAAGAAACCAGAGTTGATCAAAGACAATTATTCCTTGTACGATACT
GAAGGCGGAACACTTCTTTTGAGGGATGGACGTGTCATTATTCCGGACAATGTTGACGCCAAACGCAAAATCTTG
CAACGCTATCATGATCATCCTACTAGTGGACACCCAGGTGAACAGGAAACCTATCGACGAGTTAAACAAGTCGCT
TACTGGCCTGGAATGTCTACATTTGTCCGAAACTACGTTAAAGGCTGTGCAATGTGTCAACAGAACAAGATTAAC
CGCCATCCGTCTAATCCCCCGCTACGCCGATTGATCCACCTGGTTCTATTAGACCTTTCTCCCATATAG
Gene >Agabi119p4|709050
ATGTTGTTCTCAAAGTCTTTTAGTGATGCTGAGAGGAAATATGATATACATGACCGTGAACTATTAGCAATCAAA
CGAGCTTTCGAGGAATGGAGACACTATCTGGAAGGAGCTACTCATAAAGTTCTAGTCCGTTCAGATCATCGAAAC
CTGACATTCTGGAAGAAACCACAAAAGATCAACCACCGTCAAGCTCGATGGTATGAATTTTTGACCCGCTTTGAT
TTCGTTATAGAACATGTTCCTGGCGAAAAGATTCCGGCAGCAGACGCTTTGTCTAGACAACCCGATCACACCCCA
CCTGGATCATTAGAGGATGAACGAGTGACTCTCCTCGATGAAGATAGGTTCATTGCCGAAATCACTATCTTAGAC
CAAGCCAAATTCGTCAATGTCATTGACCTAGACTTGCAAACTGACATCATCGATGCTATGAGAAATGACAATCCG
ATGCATGAAATCGTACAAGATGTTATCAAAAAGAAACCAGAGTTGATCAAAGACAATTATTCCTTGTACGATACT
GAAGGCGGAACACTTCTTTTGAGGGATGGACGTGTCATTATTCCGGACAATGTTGACGCCAAACGCAAAATCTTG
CAACGCTATCATGATCATCCTACTAGTGGACACCCAGGTGAACAGGAAACCTATCGACGAGTTAAACAAGTCGCT
TACTGGCCTGGAATGTCTACATTTGTCCGAAACTACGTTAAAGGCTGTGCAATGTGTCAACAGAACAAGATTAAC
CGCCATCCGTCTAATCCCCCGCTACGCCGATTGATCCACCTGGTTCTATTAGACCTTTCTCCCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail