Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|705850
Gene name
Locationscaffold_08:1827237..1832882
Strand-
Gene length (bp)5645
Transcript length (bp)2796
Coding sequence length (bp)2796
Protein length (aa) 932

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20415 DUF6699 Family of unknown function (DUF6699) 6.2E-30 743 910
PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain 7.6E-20 58 287
PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59 5.5E-07 58 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7M4T0|NEG1_NEUCR Endo-1,6-beta-D-glucanase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=neg-1 PE=1 SV=2 46 418 1.0E-32
sp|Q8J0I9|GUN16_TRIHA Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum PE=1 SV=1 48 393 5.0E-32
sp|Q4WBR2|NEG1_ASPFU Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=neg1 PE=1 SV=1 46 397 2.0E-25
sp|G5ECR8|GLCM3_CAEEL Putative glucosylceramidase 3 OS=Caenorhabditis elegans GN=gba-3 PE=3 SV=1 43 409 2.0E-19
sp|O16581|GLCM2_CAEEL Putative glucosylceramidase 2 OS=Caenorhabditis elegans GN=gba-2 PE=3 SV=2 41 397 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7M4T0|NEG1_NEUCR Endo-1,6-beta-D-glucanase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=neg-1 PE=1 SV=2 46 418 1.0E-32
sp|Q8J0I9|GUN16_TRIHA Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum PE=1 SV=1 48 393 5.0E-32
sp|Q4WBR2|NEG1_ASPFU Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=neg1 PE=1 SV=1 46 397 2.0E-25
sp|G5ECR8|GLCM3_CAEEL Putative glucosylceramidase 3 OS=Caenorhabditis elegans GN=gba-3 PE=3 SV=1 43 409 2.0E-19
sp|O16581|GLCM2_CAEEL Putative glucosylceramidase 2 OS=Caenorhabditis elegans GN=gba-2 PE=3 SV=2 41 397 2.0E-16
sp|Q2KHZ8|GLCM_BOVIN Glucosylceramidase OS=Bos taurus GN=GBA PE=2 SV=1 11 410 1.0E-15
sp|Q9UB00|GLCM4_CAEEL Putative glucosylceramidase 4 OS=Caenorhabditis elegans GN=gba-4 PE=3 SV=2 54 412 3.0E-15
sp|Q5R8E3|GLCM_PONAB Glucosylceramidase OS=Pongo abelii GN=GBA PE=2 SV=1 11 410 7.0E-15
sp|Q9BDT0|GLCM_PANTR Glucosylceramidase OS=Pan troglodytes GN=GBA PE=3 SV=1 11 410 3.0E-14
sp|P04062|GLCM_HUMAN Glucosylceramidase OS=Homo sapiens GN=GBA PE=1 SV=3 11 410 6.0E-14
sp|O16580|GLCM1_CAEEL Putative glucosylceramidase 1 OS=Caenorhabditis elegans GN=gba-1 PE=1 SV=2 41 215 8.0E-14
sp|Q70KH2|GLCM_PIG Glucosylceramidase OS=Sus scrofa GN=GBA PE=3 SV=1 11 411 1.0E-13
sp|P17439|GLCM_MOUSE Glucosylceramidase OS=Mus musculus GN=Gba PE=1 SV=1 11 395 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004336 galactosylceramidase activity Yes
GO:0006683 galactosylceramide catabolic process Yes
GO:0009056 catabolic process No
GO:0019376 galactolipid catabolic process No
GO:0016042 lipid catabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006672 ceramide metabolic process No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0046479 glycosphingolipid catabolic process No
GO:0046466 membrane lipid catabolic process No
GO:0030149 sphingolipid catabolic process No
GO:0006677 glycosylceramide metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0046477 glycosylceramide catabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0006665 sphingolipid metabolic process No
GO:0006664 glycolipid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0046514 ceramide catabolic process No
GO:0044242 cellular lipid catabolic process No
GO:0019377 glycolipid catabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0006681 galactosylceramide metabolic process No
GO:0006687 glycosphingolipid metabolic process No
GO:0044237 cellular metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0003824 catalytic activity No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0009987 cellular process No
GO:0006629 lipid metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0019374 galactolipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|705850
MVPRVELCEVFVSISSTTVSSNQHCATGSLPLNFTSAGSMLGDVGIIIDDASIFQPMDGFGATLTDSSASVLNKL
KNRNYGNYQSLLNAMFNPTDGGTGAGLNYIRVPIGASDFSPSIYSLDDTVGDIAFSSFSIKQIPPYVFNVLHDIL
AVNRYVKVHLVPWSPPAWMKSGGTMNGGSLRPDMVSVYPIYLLKSVQGFRSEGIPIYAVSIQNEPQNSNPTYPSC
TMTPQVEGQIGGSLRALLNNNGLSNVKIIGYEHNWDAASQYPVQLMRTSSNSFDGVAFHCYAGSYMNQDSFTSSF
PSKEVYFTECTGTYGSDWWSDIKWYIDNLWVGSISRGSRTGLMWNFALDGSGNPKLPGTNSCGGPGCRPLVTVNS
DGTYEFNQEFYAMAQTSKAILPKDSGGSFGQRIGVSVGGSFSWALRASAFVTGRVSSTDWRRYSIVVLNWNDNTN
GDWDPIPVRATIEFRGMQVSPDLYDVLPLRLAKRTCYNSRRCIRFLLVLQHYGGLHLLVRGLIFWGRDSSKSDAR
NARTSSSGRSGQSHSRSASSTTTTSPTKSKHFKYLYADPGQTPPAPIQTTRERSTSFTAARANSPSPLRHAFKDS
GLRNHHVHPHMSTHHTSHSLDNANSKVPLYRTCSQKERPTLGQYPAFDSSHSFASVRSSNQSLYSNHSPQRYPPS
RNSSSGSVATQSTSHEPRSALKHSAHGHGSGDSTHSRHAHVSFQNPNRPTPIHMHPLLSYGRIQRAPISFNIIFP
PSSKTVVDRHTHSPIPPCTLTQPATEPPTFGRFILKCDKLPWEVVATTSGDQLHIGSMGRSSGKRFYIGPTASGR
PGSRSSSSSSIPEAVTNMDVLHAIHITLSARVTQVEWDSLGNASRAQRKATRAYEKRCNDMGGGWGAGVRRVDFL
GGKTKLVGVEIASEKLGGQSVIFGKLVFSRP*
Coding >Agabi119p4|705850
ATGGTTCCACGAGTTGAACTGTGCGAGGTCTTTGTCTCCATCTCCAGTACTACTGTATCGTCCAATCAACATTGC
GCCACTGGTAGTTTACCACTGAATTTTACTTCCGCTGGATCCATGCTGGGTGACGTCGGCATCATCATTGACGAT
GCATCCATATTCCAACCAATGGATGGTTTTGGGGCCACGCTCACCGATTCCTCAGCCTCAGTTTTGAATAAACTG
AAGAACCGTAACTATGGAAATTACCAAAGTCTCCTTAACGCCATGTTCAACCCTACTGATGGTGGTACTGGGGCT
GGTCTCAACTACATCCGCGTCCCAATCGGTGCTTCAGATTTCTCCCCCTCTATCTATAGTCTAGACGATACAGTC
GGAGACATCGCTTTCTCCAGTTTTAGCATCAAGCAGATACCGCCTTATGTCTTCAACGTTTTACATGACATTCTG
GCTGTGAACAGATATGTCAAAGTTCACCTGGTACCCTGGTCGCCTCCCGCGTGGATGAAATCAGGTGGTACGATG
AACGGTGGATCCCTCAGGCCTGACATGGTTAGCGTCTATCCGATATACCTCCTCAAGTCGGTCCAGGGCTTCCGC
AGCGAGGGCATACCTATCTACGCTGTTAGCATTCAGAATGAACCACAAAATAGTAATCCCACCTATCCCTCGTGC
ACAATGACACCTCAGGTAGAAGGTCAAATTGGCGGAAGCCTTCGAGCATTGTTGAACAATAATGGACTCTCGAAT
GTAAAAATCATAGGTTACGAGCACAACTGGGATGCGGCAAGCCAATATCCTGTTCAGTTGATGCGAACTAGTTCT
AATTCATTCGATGGCGTTGCCTTCCATTGCTATGCCGGATCATACATGAACCAAGACTCGTTTACGAGCTCATTT
CCATCAAAGGAGGTTTACTTCACGGAATGTACCGGTACGTACGGTTCAGACTGGTGGAGTGATATTAAATGGTAT
ATCGATAACCTATGGGTTGGAAGTATATCTCGGGGATCTCGGACGGGTTTAATGTGGAATTTTGCATTGGATGGA
AGTGGTAACCCAAAGCTTCCCGGTACCAACAGTTGTGGAGGCCCAGGATGCAGACCTCTTGTCACAGTCAATTCG
GATGGGACCTACGAATTTAATCAAGAATTCTACGCTATGGCTCAAACATCCAAAGCAATTCTTCCAAAGGACAGC
GGTGGTTCTTTTGGACAACGAATTGGAGTAAGCGTGGGAGGTTCCTTTTCATGGGCCCTTCGAGCCTCGGCCTTC
GTAACAGGCAGAGTCTCGTCCACCGATTGGCGTCGTTACTCCATCGTGGTCCTGAACTGGAATGATAATACAAAC
GGAGATTGGGATCCGATCCCTGTTCGAGCGACAATCGAGTTTCGTGGCATGCAGGTGAGCCCCGACCTCTATGAC
GTTTTGCCTCTTCGCTTGGCTAAGCGAACGTGTTACAATTCCAGGCGATGTATACGTTTCCTGTTGGTGTTACAA
CATTATGGTGGTTTGCACCTGCTCGTTAGGGGCCTCATTTTCTGGGGGCGCGATTCCTCCAAGTCGGATGCCCGC
AATGCTCGCACGTCGTCCTCCGGTAGGAGTGGCCAGTCGCACTCACGTTCAGCTTCTTCTACTACGACGACCTCG
CCTACCAAGTCCAAACACTTCAAGTACCTTTACGCAGATCCCGGACAAACTCCACCTGCCCCGATCCAGACCACG
CGCGAGCGAAGCACGAGCTTTACTGCTGCTCGAGCCAACTCTCCCTCTCCTTTACGACACGCGTTCAAAGATTCT
GGGTTGCGGAATCACCATGTCCACCCTCACATGTCAACTCACCACACTAGTCATTCGTTGGATAATGCAAATTCA
AAAGTACCTTTGTACCGTACCTGCAGTCAGAAGGAACGTCCAACATTAGGACAATACCCTGCCTTTGATTCCAGT
CATTCTTTTGCAAGCGTCCGATCATCAAACCAGTCCCTTTATTCTAATCATTCGCCCCAACGGTATCCTCCCTCA
CGTAATTCAAGTTCCGGCAGTGTTGCGACTCAATCAACTTCTCATGAGCCAAGGTCCGCATTAAAGCACAGTGCC
CATGGACATGGCTCGGGGGATTCTACACATAGTCGTCACGCGCACGTTTCGTTCCAAAACCCCAACCGGCCTACA
CCGATCCACATGCACCCACTTTTGAGTTACGGCCGTATTCAACGAGCTCCCATCTCCTTTAACATCATTTTCCCC
CCTTCTTCTAAAACCGTTGTTGACAGGCATACCCATTCGCCTATCCCTCCCTGCACACTTACTCAGCCAGCCACA
GAACCACCCACTTTCGGTCGCTTCATCCTAAAATGCGATAAACTTCCTTGGGAGGTGGTGGCAACAACCAGCGGA
GATCAATTGCACATTGGGAGTATGGGGCGTTCTTCCGGTAAAAGGTTTTACATTGGGCCCACGGCATCTGGTAGG
CCCGGGTCGCGTTCGAGCAGCTCAAGTAGTATTCCTGAAGCTGTCACGAATATGGACGTACTACATGCGATTCAT
ATCACCCTGTCGGCCCGTGTCACTCAAGTGGAGTGGGATTCACTCGGCAATGCAAGTCGGGCACAACGGAAAGCA
ACAAGAGCTTATGAGAAGCGGTGCAATGATATGGGCGGAGGCTGGGGGGCCGGAGTTCGACGGGTTGATTTCCTT
GGTGGGAAGACGAAACTTGTCGGCGTTGAGATTGCAAGTGAAAAGCTTGGTGGTCAGTCAGTAATTTTTGGAAAG
CTTGTTTTTTCTCGTCCTTGA
Transcript >Agabi119p4|705850
ATGGTTCCACGAGTTGAACTGTGCGAGGTCTTTGTCTCCATCTCCAGTACTACTGTATCGTCCAATCAACATTGC
GCCACTGGTAGTTTACCACTGAATTTTACTTCCGCTGGATCCATGCTGGGTGACGTCGGCATCATCATTGACGAT
GCATCCATATTCCAACCAATGGATGGTTTTGGGGCCACGCTCACCGATTCCTCAGCCTCAGTTTTGAATAAACTG
AAGAACCGTAACTATGGAAATTACCAAAGTCTCCTTAACGCCATGTTCAACCCTACTGATGGTGGTACTGGGGCT
GGTCTCAACTACATCCGCGTCCCAATCGGTGCTTCAGATTTCTCCCCCTCTATCTATAGTCTAGACGATACAGTC
GGAGACATCGCTTTCTCCAGTTTTAGCATCAAGCAGATACCGCCTTATGTCTTCAACGTTTTACATGACATTCTG
GCTGTGAACAGATATGTCAAAGTTCACCTGGTACCCTGGTCGCCTCCCGCGTGGATGAAATCAGGTGGTACGATG
AACGGTGGATCCCTCAGGCCTGACATGGTTAGCGTCTATCCGATATACCTCCTCAAGTCGGTCCAGGGCTTCCGC
AGCGAGGGCATACCTATCTACGCTGTTAGCATTCAGAATGAACCACAAAATAGTAATCCCACCTATCCCTCGTGC
ACAATGACACCTCAGGTAGAAGGTCAAATTGGCGGAAGCCTTCGAGCATTGTTGAACAATAATGGACTCTCGAAT
GTAAAAATCATAGGTTACGAGCACAACTGGGATGCGGCAAGCCAATATCCTGTTCAGTTGATGCGAACTAGTTCT
AATTCATTCGATGGCGTTGCCTTCCATTGCTATGCCGGATCATACATGAACCAAGACTCGTTTACGAGCTCATTT
CCATCAAAGGAGGTTTACTTCACGGAATGTACCGGTACGTACGGTTCAGACTGGTGGAGTGATATTAAATGGTAT
ATCGATAACCTATGGGTTGGAAGTATATCTCGGGGATCTCGGACGGGTTTAATGTGGAATTTTGCATTGGATGGA
AGTGGTAACCCAAAGCTTCCCGGTACCAACAGTTGTGGAGGCCCAGGATGCAGACCTCTTGTCACAGTCAATTCG
GATGGGACCTACGAATTTAATCAAGAATTCTACGCTATGGCTCAAACATCCAAAGCAATTCTTCCAAAGGACAGC
GGTGGTTCTTTTGGACAACGAATTGGAGTAAGCGTGGGAGGTTCCTTTTCATGGGCCCTTCGAGCCTCGGCCTTC
GTAACAGGCAGAGTCTCGTCCACCGATTGGCGTCGTTACTCCATCGTGGTCCTGAACTGGAATGATAATACAAAC
GGAGATTGGGATCCGATCCCTGTTCGAGCGACAATCGAGTTTCGTGGCATGCAGGTGAGCCCCGACCTCTATGAC
GTTTTGCCTCTTCGCTTGGCTAAGCGAACGTGTTACAATTCCAGGCGATGTATACGTTTCCTGTTGGTGTTACAA
CATTATGGTGGTTTGCACCTGCTCGTTAGGGGCCTCATTTTCTGGGGGCGCGATTCCTCCAAGTCGGATGCCCGC
AATGCTCGCACGTCGTCCTCCGGTAGGAGTGGCCAGTCGCACTCACGTTCAGCTTCTTCTACTACGACGACCTCG
CCTACCAAGTCCAAACACTTCAAGTACCTTTACGCAGATCCCGGACAAACTCCACCTGCCCCGATCCAGACCACG
CGCGAGCGAAGCACGAGCTTTACTGCTGCTCGAGCCAACTCTCCCTCTCCTTTACGACACGCGTTCAAAGATTCT
GGGTTGCGGAATCACCATGTCCACCCTCACATGTCAACTCACCACACTAGTCATTCGTTGGATAATGCAAATTCA
AAAGTACCTTTGTACCGTACCTGCAGTCAGAAGGAACGTCCAACATTAGGACAATACCCTGCCTTTGATTCCAGT
CATTCTTTTGCAAGCGTCCGATCATCAAACCAGTCCCTTTATTCTAATCATTCGCCCCAACGGTATCCTCCCTCA
CGTAATTCAAGTTCCGGCAGTGTTGCGACTCAATCAACTTCTCATGAGCCAAGGTCCGCATTAAAGCACAGTGCC
CATGGACATGGCTCGGGGGATTCTACACATAGTCGTCACGCGCACGTTTCGTTCCAAAACCCCAACCGGCCTACA
CCGATCCACATGCACCCACTTTTGAGTTACGGCCGTATTCAACGAGCTCCCATCTCCTTTAACATCATTTTCCCC
CCTTCTTCTAAAACCGTTGTTGACAGGCATACCCATTCGCCTATCCCTCCCTGCACACTTACTCAGCCAGCCACA
GAACCACCCACTTTCGGTCGCTTCATCCTAAAATGCGATAAACTTCCTTGGGAGGTGGTGGCAACAACCAGCGGA
GATCAATTGCACATTGGGAGTATGGGGCGTTCTTCCGGTAAAAGGTTTTACATTGGGCCCACGGCATCTGGTAGG
CCCGGGTCGCGTTCGAGCAGCTCAAGTAGTATTCCTGAAGCTGTCACGAATATGGACGTACTACATGCGATTCAT
ATCACCCTGTCGGCCCGTGTCACTCAAGTGGAGTGGGATTCACTCGGCAATGCAAGTCGGGCACAACGGAAAGCA
ACAAGAGCTTATGAGAAGCGGTGCAATGATATGGGCGGAGGCTGGGGGGCCGGAGTTCGACGGGTTGATTTCCTT
GGTGGGAAGACGAAACTTGTCGGCGTTGAGATTGCAAGTGAAAAGCTTGGTGGTCAGTCAGTAATTTTTGGAAAG
CTTGTTTTTTCTCGTCCTTGA
Gene >Agabi119p4|705850
ATGGTTCCACGAGTTGAACTGTGCGAGGTCTTTGTCTCCATCTCCAGTACTACTGTATCGTCCAATCAACATTGG
TAAAGAATGCGTGGAGCAACAATGGATGAACCGGGTGTTGGAGAGCTTGATTATGTGGCAGGAAACCTAAGGATG
AATGTAAACAGCGTGAGTTGGTCCGGCCGTTCTCAGACGCAGTTGGTGTTGATTCTCCAGTTCACAAAGGGGCAT
TGTTATTACACTGCTAAGACCCAGCAATATACATGTCCAAGACTTTCGAAGTTTATCCTCCCGGTGACCGAGGCA
AATATGATGCTCAACTCAGCCCCTACTGTTCATTTACTTCCTTGAGCTGTCAGCTTGATATGCTTACACGGATGT
CCTTTGAACCACCTGTTGTAATCTCAGCATCTCCCAAATGCGGTCTGCTTTCTCCTTCTCCCTCACATCTGCGGA
GATGGTCATGACCAAACGGTAGGTATCATATCCTCGTTATGAAGCCCACCGTTCGGTGGATACTTATGAATCACC
AGGTCGAAGTTGCACGCGTTTTAAGGGCTATGATGTATGTGTGCAAGAGACTAGTAGCCTTGGGAGGGCCGAACG
TCCTTCATTCAGTTCATGATTCTATATGCTCCGTAAGTCGACGTGCGCTCCATGCTTCGGCTTGACTATCCGTCC
CACCTCCGAGTCCTCGTGAGGAGGTCAGATGGGCAAATCAAGTCAGGATCTCGGAACGCACGTCGTATATAATGG
CCTGTCTGTTTCTCAAGATTGTATCAAGAGACGCGCTCGACCCACTGCTGTAAAGCGTTCGAGGAGCTTTTTCTT
GTCTTATCAATGGCTCATCGAGGAATTTCGGTTCTACTCGTATTCATAACTCTGGGTTCGTCTCAACAAATTTGG
GATATCGTCAGTAACCGTTTCACCTTCCCTTTGACCTATGGCTTGCCGCTCTTACCACGTTATTCGTGCTTTGCC
TTTCCCATTTTAGTGGCAAACGACATGGGATCGCTCGAATCTTTTTTCACCTGTTGGTGCCAGCGCCACTGGTAG
TTTACCACTGAATTTTACTTCCGCTGGATCCATGCTGGGTGACGTCGGCATCATCATTGACGATGCATCCATATT
CCAACCAATGGATGGTTTTGGGGCCACGCTCAGTGAGTTTTGCTGTTTATTTCGTCCTCTAACTTACAGATTCTA
ATAAGTCAATCTACATAGCCGATTCCTCAGCCTCAGTTTTGAATAAACTGAAGGTGTGTAACACACTGACTGACT
CAACTTTCTGCGGACTCAAGCTAAGCGTAGAACCGTAACTATGGAAATTACCAAAGTCTCCTTAACGCCATGTTC
AACCCTACTGATGGTGGTACTGGGGCTGGTCTCAACTACATCCGCGTCCCAATCGGTGCTTCAGATTTCTCCCCC
TCTAGTATGTTTGGTTGAATTCTATCACACAAACGCACCACGTGCTAATGCCACTATACTCCATCAAGTCTATAG
TCTAGACGATACAGTCGGAGACATCGCTTTCTCCAGTTTTAGCATCAAGCAGATACCGCCTTATGTCTTCAACGT
TTTACATGACATTCTGGCTGTGAACAGATATGTCAAAGTTCACCTGGTACCCTGGTCGCCTGTAAGGCTGTTTCT
GTTTGATCGTTATATATGCTATTTAACGCTACGAGTAGCCCGCGTGGATGAAATCAGGTGGTACGATGAACGGTG
GATCCCTCAGGCCTGACATGGTTAGCGTCTGTGAGTCCTCGCACAATTCAAAGTCAGGATACATTTACTTCCACT
ATTTTAGATCCGATATACCTCCTCAAGTCGGTCCAGGGCTTCCGCAGCGAGGGCATACCTATCTACGCTGTTAGC
ATTCAGGTACGCCACCGGTGGAGTGTCATTTCCCGACTATGCTCAGCCAACTAGAATGAACCACAAAATAGTAAT
CCCACCTATCCCTCGTGCACAATGACACCTCAGGTAGAAGGTCAAATTGGCGGAAGCCTTCGAGCATTGTTGAAC
AATAATGGACTCTCGAATGTAAAAATCATAGGTTACGAGGTAAGTCCCTTCTCGGGCTCATCTTCTTCATATATA
CACTAGCTTACCTCCTGAATCATCCAGCACAACTGGGATGCGGCAAGCCAATATCCTGTTCAGTTGGTACGCCGC
CTGCCATACCGCATCGATTTTTTGAAAACCTGACTGAGACTACCGCGCTCAACGCTCCTAGATGCGAACTAGTTC
TAATTCATTCGATGGCGTTGCCTTCCATTGCTATGCCGGATCATACATGAACCAAGACTCGTTTACGAGCTCATT
TCCATCAAAGGTACACCTTTTCCTACATTCAACCAAATATTCCCCCCTGAAGACGATACCTAGGAGGTTTACTTC
ACGGAATGTACCGGTACGTACGGTTCAGACTGGTGGAGTGATATTAAAGTGAGTTGATTCTGCCGTGAAGAGTTA
TAGTTCATTCCGTCTCACACGTATCCAAGTGGTATATCGATAACCTGTATGTGGTACAAGCCGTTTTTCTCGGCC
GAAGTCGGTTTACTAAGCTTTTTTATACTCTTTCCAGATGGGTTGGAAGTATATCTCGGGGATCTCGGACGGTAG
GTTGATTTCGCAATATGTACTCTGGAACGCGGTACTGATGCCTTTAAAGGGTTTAATGTGGAATTTTGCATTGGA
TGGAAGTGGTAACCCAAAGCTTCCCGGTACCAACAGTTGTGGAGGCCCAGGATGCAGACCTCTTGTCACAGTCAA
TTCGGATGGGACCTACGAATTTAATCAAGAATGTAGGCGTGATGTGTTGTGTGTGGTAGAAACACTAAAGCCTTT
GTTTTCGGCATAGTCTACGCTATGGCTCAAACATCCAAAGCAATTCTTCCAAAGGACAGCGGTGGTTCTTTTGGA
CAACGAATTGGAGTAAGCGTGGGAGGTTCCTTTTCATGGGCCCTTCGAGCCTCGGCCTTCGTAACAGGCAGAGTC
TCGTCCACCGATTGGCGTCGTTACTCCATCGTGGTCCTGAACTGTGAGTGAAAGCCATATAACTTCGCTGTTTTC
ATATCTTCGACCATCATTGGTATTAAATTCTTTCTGACATCGTCCAGGGAATGATAATACAAACGGAGATTGGGA
TCCGATCCCTGTTCGAGCGACAATCGAGTTTCGTGGCATGCAGGTGAGCCCCGACCTCTATGACGTTTTGCCTCT
TCGCTTGGCTAAGCGAACGTGTTACAATTCCAGGCGATGTATACGTTTCCTGTTGGTGTTACAACATTATGGTGG
TTTGCACCTGCTCGTTAGGGGCCTGTGGGTGATCGTAAGCCTTGATCTCAACGTGAAAATCGCGTGAAGGACGAG
AGTACATAACAAGACACGTATAAATAATGTATTTTTATTTCCAAGGTCCTAAAATTTGATTTTCTCCCATGAGTT
TCTGACTTTGCTGAGTCGGCGAACTAGGGGGGTGATGATCGATCCACAAAGTATTGATAAATATTCAATCAGCCG
CGTCGCTGCTGCGGTTACTTCATTTGTACCTCATAACAGAACACGAGGGGGTCTATCGGCGTGCTCTTTAGACGA
CGCGATGGCTCGGGGTCGCGGCTGACCCTGCTGTCTAGCTTCACCTCACGAAATCGAGTAGGGTATGTAGTTTCC
TAACTTCACCGTCGAAAGTAGATTCATGCTATAAATTGCTGATCTGTGGTCAACATCTTGTACCGCTAAAAGCTG
AGATAGTCGTTTCTTGTGAAGAAGAGATACTGGACCAAACGAAAATTGCTCAGGGTCTTTTTGATCAGAAGGCAT
GATAAAGATTTGTAAACGGCTGTGGCCTTGGACCCTGAAATGTTTCTTTTCTCGCGCCTTGTCACCTTTATAGGG
TTTATTCCCCTACTACCCCTACCCAATGCATATTTTTTACCTCATATTACAAACAGGAAGTTCGTAATTCGGCTC
AATGGTCCAATCGTGAAAAATCGCCAAGGGTATGGTTATGAACAGGTGGTTCATTCAGTGCAGCCCGACGTTCTT
TCTTGATAAATGCTGATGGTTCTGGACGACCACGACGCTTTCGTTCGGCCCCTTGCGCTAGAATCGGTCGTACCG
ATCATGGCCGAGCCTTACGAAACTATTGCCTCCCTCCCACCTTCATGATTTTTTCTAACCGCATATATACTCCAT
TGGAGTACGCTTCATTGACCTTGTCCACCTCTACGCACTCCTCCTAGATCGTAGAAAAATGGCGTCTTACTTGCG
AAGCATTTTCTGGGGGCGCGATTCCTCCAAGTCGGATGCCCGCAATGCTCGCACGTCGTCCTCCGGTAGGAGTGG
CCAGTCGCACTCACGTTCAGCTTCTTCTACTACGACGACCTCGCCTACCAAGTCCAAACACTTCAAGTACCTTTA
CGCAGATCCCGGACAAACTCCACCTGCCCCGATCCAGACCACGCGCGAGCGAAGCACGAGCTTTACTGCTGCTCG
AGCCAACTCTCCCTCTCCTTTACGACACGCGTTCAAAGATTCTGGGTTGCGGAATCACCATGTCCACCCTCACAT
GTCAACTCACCACACTAGTCATTCGTTGGATAATGCAAATTCAAAAGTACCTTTGTACCGTACCTGCAGTCAGAA
GGAACGTCGTAAGTCACAACGTTGCTTTCCGATAGGGCTGTAGCTCATAGACATCGCCAGCAACATTAGGACAAT
ACCCTGCCTTTGATTCCAGTCATTCTTTTGCAAGCGTCCGATCATCAAACCAGTCCCTTTATTCTAATCATTCGC
CCCAACGGTATCCTCCCTCACGTAATTCAAGTTCCGGCAGTGTTGCGACTCAATCAACTTCTCATGAGCCAAGGT
CCGCATTAAAGCACAGTGCCCATGGACATGGCTCGGGGGATTCTACACATAGTCGTCGTACGTGAAAACACCCTC
CGGTTATATAATTTTAACGAACATTGCCACCATCAGACGCGCACGTTTCGTTCCAAAACCCCAACCGGCCTACAC
CGATCCACATGCACCCACTTTTGAGTTACGGCCGTATTCAACGAGCTCCCATCTCCTTTAACATCATTTTCCCCC
CTTCTTCTAAAACCGTTGTTGACAGGCATACCCATTCGCCTATCCCTCCCTGCACACTTACTCAGCCAGCCACAG
AACCACCCACTTTCGGTCGCTTCATCCTAAAATGCGATAAACTTCCTTGGGAGGTGGTGGCAACAACCAGCGGAG
ATCAATTGCACATTGGGAGTATGGGGCGTTCTTCCGGTAAAAGGTTTTACATTGGGCCCACGGCATCTGGTAGGC
CCGGGTCGCGTTCGAGCAGCTCAAGTAGTATTCCTGAAGCTGTCACGAATATGGACGTACTACATGCGATTCATA
TCACCCTGTCGGCCCGTGTCACTCAAGTGGAGTGGGATTCACTCGGCAATGCAAGTCGGGCACAACGGAAAGCAA
CAAGAGCTTATGAGAAGCGGTGCAATGATATGGGCGGAGGCTGGGGGGCCGGAGTTCGACGGGTTGATTTCCTTG
GTGGGAAGACGAAACTTGTCGGCGTTGAGATTGCAAGTGAAAAGCTTGGTGGTCAGTCAGTAATTTTTGGAAAGC
TTGTTTTTTCTCGTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail