Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|704950
Gene name
Locationscaffold_08:1723832..1724359
Strand+
Gene length (bp)527
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06914|CSP_PLAYO Circumsporozoite protein OS=Plasmodium yoelii yoelii PE=1 SV=1 34 128 1.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 44 133 5.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 44 133 5.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 43 133 5.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 44 133 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06914|CSP_PLAYO Circumsporozoite protein OS=Plasmodium yoelii yoelii PE=1 SV=1 34 128 1.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 44 133 5.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 44 133 5.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 43 133 5.0E-07
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 44 133 2.0E-06
sp|Q95P23|ENPP_APLCA Enterin neuropeptides OS=Aplysia californica GN=ENPP PE=1 SV=1 44 133 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|704950
MRSLTFFALIASVLAATVTAVPLENSNLPGRDVDLETSATPGAPGWKRSEQGPGAPGWKRSEQGPGAPGWKRKEQ
GPGAPGWKREEQGPGAPGWKRKEQGPGAPGWKRSEQGPGAPGWKRKEQGPGAPGWKRTEDIPA*
Coding >Agabi119p4|704950
ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC
TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA
CAGGGTCCAGGCGCTCCTGGATGGAAGCGCAGTGAACAAGGTCCCGGTGCTCCGGGGTGGAAGCGCAAAGAACAA
GGTCCCGGTGCTCCGGGGTGGAAACGCGAAGAACAAGGTCCAGGTGCTCCTGGATGGAAGCGCAAAGAACAAGGC
CCGGGTGCTCCTGGTTGGAAACGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAGGGTCCT
GGTGCTCCTGGTTGGAAGCGCACTGAGGATATTCCTGCCTAA
Transcript >Agabi119p4|704950
ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC
TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA
CAGGGTCCAGGCGCTCCTGGATGGAAGCGCAGTGAACAAGGTCCCGGTGCTCCGGGGTGGAAGCGCAAAGAACAA
GGTCCCGGTGCTCCGGGGTGGAAACGCGAAGAACAAGGTCCAGGTGCTCCTGGATGGAAGCGCAAAGAACAAGGC
CCGGGTGCTCCTGGTTGGAAACGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAGGGTCCT
GGTGCTCCTGGTTGGAAGCGCACTGAGGATATTCCTGCCTAA
Gene >Agabi119p4|704950
ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGTATGT
TAGATCTTTGAATCCTTCTATTTTGCCCCTCGTTTACCCTACCTGTAGGAGAACTCGAATCTCCCCGGTCGTGAT
GTAGACTTGGAGACGTCAGCTACTGTTGGTTTATTTTTCTCTCCGGCGCCTTATCTATTTAATCACATTCGTGCT
CTCAGCCTGGTGCCCCTGGTTGGAAGCGCAGTGAACAGGGTCCAGGCGCTCCTGGATGGAAGCGCAGTGAACAAG
GTCCCGGTGCTCCGGGGTGGAAGCGCAAAGAACAAGGTCCCGGTGCTCCGGGGTGGAAACGCGAAGAACAAGGTC
CAGGTGCTCCTGGATGGAAGCGCAAAGAACAAGGCCCGGGTGCTCCTGGTTGGAAACGCAGTGAACAAGGTCCAG
GCGCTCCGGGGTGGAAGCGTAAGGAACAGGGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGATATTCCTGCCT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail