Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|703400
Gene name
Locationscaffold_08:1417743..1418557
Strand+
Gene length (bp)814
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 3.5E-38 24 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P958|TMEDA_USTMA Endoplasmic reticulum vesicle protein 25 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERV25 PE=3 SV=1 21 218 7.0E-83
sp|P0CN72|TMEDA_CRYNJ Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ERV25 PE=3 SV=1 3 218 2.0E-74
sp|P0CN73|TMEDA_CRYNB Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ERV25 PE=3 SV=1 3 218 8.0E-72
sp|Q5B5L5|TMEDA_EMENI Endoplasmic reticulum vesicle protein 25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erv25 PE=3 SV=1 7 217 1.0E-41
sp|Q9HEK4|TMEDA_NEUCR Endoplasmic reticulum vesicle protein 25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erv-1 PE=3 SV=3 23 217 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P958|TMEDA_USTMA Endoplasmic reticulum vesicle protein 25 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERV25 PE=3 SV=1 21 218 7.0E-83
sp|P0CN72|TMEDA_CRYNJ Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ERV25 PE=3 SV=1 3 218 2.0E-74
sp|P0CN73|TMEDA_CRYNB Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ERV25 PE=3 SV=1 3 218 8.0E-72
sp|Q5B5L5|TMEDA_EMENI Endoplasmic reticulum vesicle protein 25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erv25 PE=3 SV=1 7 217 1.0E-41
sp|Q9HEK4|TMEDA_NEUCR Endoplasmic reticulum vesicle protein 25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erv-1 PE=3 SV=3 23 217 1.0E-40
sp|Q5A302|TMEDA_CANAL Endoplasmic reticulum vesicle protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERV25 PE=3 SV=1 1 217 3.0E-38
sp|Q6BTC2|TMEDA_DEBHA Endoplasmic reticulum vesicle protein 25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERV25 PE=3 SV=2 3 217 4.0E-37
sp|Q4HY20|TMEDA_GIBZE Endoplasmic reticulum vesicle protein 25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERV25 PE=3 SV=1 3 217 9.0E-36
sp|Q4WQL0|TMEDA_ASPFU Endoplasmic reticulum vesicle protein 25 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erv25 PE=3 SV=1 21 212 1.0E-35
sp|Q6CWW7|TMEDA_KLULA Endoplasmic reticulum vesicle protein 25 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERV25 PE=3 SV=1 1 217 3.0E-35
sp|P54837|TMEDA_YEAST Endoplasmic reticulum vesicle protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV25 PE=1 SV=1 5 217 4.0E-35
sp|Q6FRZ3|TMEDA_CANGA Endoplasmic reticulum vesicle protein 25 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERV25 PE=3 SV=2 21 217 3.0E-32
sp|O13946|TMEDA_SCHPO Endoplasmic reticulum vesicle protein 25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv25 PE=3 SV=1 1 217 2.0E-31
sp|Q9D1D4|TMEDA_MOUSE Transmembrane emp24 domain-containing protein 10 OS=Mus musculus GN=Tmed10 PE=1 SV=1 11 218 4.0E-28
sp|Q90515|TMEDA_TAKRU Transmembrane emp24 domain-containing protein 10 OS=Takifugu rubripes GN=tmed10 PE=3 SV=1 5 218 1.0E-27
sp|Q63584|TMEDA_RAT Transmembrane emp24 domain-containing protein 10 OS=Rattus norvegicus GN=Tmed10 PE=1 SV=2 16 218 3.0E-27
sp|Q5E971|TMEDA_BOVIN Transmembrane emp24 domain-containing protein 10 OS=Bos taurus GN=TMED10 PE=2 SV=1 6 218 1.0E-26
sp|Q28735|TMEDA_RABIT Transmembrane emp24 domain-containing protein 10 OS=Oryctolagus cuniculus GN=TMED10 PE=1 SV=1 16 218 2.0E-26
sp|O35587|TMEDA_MESAU Transmembrane protein Tmp21 OS=Mesocricetus auratus GN=TMED10 PE=1 SV=1 16 218 3.0E-25
sp|Q6C503|TMEDA_YARLI Endoplasmic reticulum vesicle protein 25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERV25 PE=3 SV=1 5 217 2.0E-24
sp|Q759T8|TMEDA_ASHGO Endoplasmic reticulum vesicle protein 25 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERV25 PE=3 SV=1 4 217 2.0E-24
sp|P49755|TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens GN=TMED10 PE=1 SV=2 20 218 2.0E-24
sp|Q5RE32|TMEDA_PONAB Transmembrane emp24 domain-containing protein 10 OS=Pongo abelii GN=TMED10 PE=2 SV=1 20 218 8.0E-24
sp|Q99KF1|TMED9_MOUSE Transmembrane emp24 domain-containing protein 9 OS=Mus musculus GN=Tmed9 PE=1 SV=2 35 217 3.0E-20
sp|Q3T133|TMED9_BOVIN Transmembrane emp24 domain-containing protein 9 OS=Bos taurus GN=TMED9 PE=1 SV=1 35 217 3.0E-20
sp|Q5I0E7|TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus GN=Tmed9 PE=1 SV=1 35 217 3.0E-20
sp|Q9BVK6|TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens GN=TMED9 PE=1 SV=2 33 217 3.0E-20
sp|B4LYB8|TMEDE_DROVI Transmembrane emp24 domain-containing protein eca OS=Drosophila virilis GN=eca PE=3 SV=1 6 217 2.0E-19
sp|B4HJV5|TMEDE_DROSE Transmembrane emp24 domain-containing protein eca OS=Drosophila sechellia GN=eca PE=3 SV=1 6 217 3.0E-19
sp|Q9I7K5|TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster GN=eca PE=2 SV=2 6 217 3.0E-19
sp|B4QWH9|TMEDE_DROSI Transmembrane emp24 domain-containing protein eca OS=Drosophila simulans GN=eca PE=3 SV=1 6 217 3.0E-19
sp|B4PVC6|TMEDE_DROYA Transmembrane emp24 domain-containing protein eca OS=Drosophila yakuba GN=eca PE=3 SV=1 6 217 4.0E-19
sp|B3NZM5|TMEDE_DROER Transmembrane emp24 domain-containing protein eca OS=Drosophila erecta GN=eca PE=3 SV=1 6 217 6.0E-19
sp|B4JG34|TMEDE_DROGR Transmembrane emp24 domain-containing protein eca OS=Drosophila grimshawi GN=eca PE=3 SV=1 61 217 1.0E-18
sp|B4KB41|TMEDE_DROMO Transmembrane emp24 domain-containing protein eca OS=Drosophila mojavensis GN=eca PE=3 SV=1 9 217 1.0E-18
sp|Q295B2|TMEDE_DROPS Transmembrane emp24 domain-containing protein eca OS=Drosophila pseudoobscura pseudoobscura GN=eca PE=3 SV=1 61 217 1.0E-18
sp|B4NKL0|TMEDE_DROWI Transmembrane emp24 domain-containing protein eca OS=Drosophila willistoni GN=eca PE=3 SV=1 6 217 2.0E-18
sp|B3MTS8|TMEDE_DROAN Transmembrane emp24 domain-containing protein eca OS=Drosophila ananassae GN=eca PE=3 SV=1 61 217 2.0E-18
sp|B4GMC3|TMEDE_DROPE Transmembrane emp24 domain-containing protein eca OS=Drosophila persimilis GN=eca PE=3 SV=1 61 217 2.0E-18
sp|Q7Z7H5|TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens GN=TMED4 PE=1 SV=1 61 217 8.0E-17
sp|Q8R1V4|TMED4_MOUSE Transmembrane emp24 domain-containing protein 4 OS=Mus musculus GN=Tmed4 PE=1 SV=1 61 217 9.0E-17
sp|Q6IDL4|P24D3_ARATH Transmembrane emp24 domain-containing protein p24delta3 OS=Arabidopsis thaliana GN=At1g09580 PE=1 SV=1 6 217 3.0E-15
sp|B4NIY1|TMEDA_DROWI Transmembrane emp24 domain-containing protein bai OS=Drosophila willistoni GN=bai PE=3 SV=1 117 218 4.0E-15
sp|B4JYU5|TMEDA_DROGR Transmembrane emp24 domain-containing protein bai OS=Drosophila grimshawi GN=bai PE=3 SV=2 128 218 9.0E-15
sp|B4K4G5|TMEDA_DROMO Transmembrane emp24 domain-containing protein bai OS=Drosophila mojavensis GN=bai PE=3 SV=1 121 218 1.0E-14
sp|B3LVB0|TMEDA_DROAN Transmembrane emp24 domain-containing protein bai OS=Drosophila ananassae GN=bai PE=3 SV=1 121 218 1.0E-14
sp|Q9FVU0|P24D4_ARATH Transmembrane emp24 domain-containing protein p24delta4 OS=Arabidopsis thaliana GN=CYB PE=1 SV=1 31 217 2.0E-14
sp|B4MGF8|TMEDA_DROVI Transmembrane emp24 domain-containing protein bai OS=Drosophila virilis GN=bai PE=3 SV=1 128 218 2.0E-14
sp|Q8SXY6|TMEDA_DROME Transmembrane emp24 domain-containing protein bai OS=Drosophila melanogaster GN=bai PE=2 SV=1 128 218 3.0E-14
sp|B3P6T8|TMEDA_DROER Transmembrane emp24 domain-containing protein bai OS=Drosophila erecta GN=bai PE=3 SV=1 128 218 3.0E-14
sp|A0AQ71|TMEDA_DROSI Transmembrane emp24 domain-containing protein bai OS=Drosophila simulans GN=bai PE=3 SV=1 121 218 3.0E-14
sp|B4PUZ3|TMEDA_DROYA Transmembrane emp24 domain-containing protein bai OS=Drosophila yakuba GN=bai PE=3 SV=1 128 218 3.0E-14
sp|Q8RWM6|P24D5_ARATH Transmembrane emp24 domain-containing protein p24delta5 OS=Arabidopsis thaliana GN=At1g21900 PE=1 SV=1 114 217 5.0E-14
sp|B4GE47|TMEDA_DROPE Transmembrane emp24 domain-containing protein bai OS=Drosophila persimilis GN=bai PE=3 SV=1 128 218 5.0E-14
sp|Q8GYG1|P24D7_ARATH Transmembrane emp24 domain-containing protein p24delta7 OS=Arabidopsis thaliana GN=At1g14010 PE=2 SV=1 11 217 5.0E-12
sp|Q9D2R4|TMD11_MOUSE Transmembrane emp24 domain-containing protein 11 OS=Mus musculus GN=Tmed11 PE=1 SV=1 20 217 3.0E-10
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 35 214 2.0E-09
sp|Q9LQY3|P24D9_ARATH Transmembrane emp24 domain-containing protein p24delta9 OS=Arabidopsis thaliana GN=At1g26690 PE=2 SV=1 5 217 3.0E-09
sp|Q9LJV9|P24DB_ARATH Transmembrane emp24 domain-containing protein p24delta11 OS=Arabidopsis thaliana GN=At3g29070 PE=2 SV=1 121 217 5.0E-09
sp|F4J4Y0|P24D6_ARATH Transmembrane emp24 domain-containing protein p24delta6 OS=Arabidopsis thaliana GN=At3g10780 PE=1 SV=1 49 217 6.0E-09
sp|P32803|EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP24 PE=1 SV=1 90 217 3.0E-08
sp|Q8VY92|P24DA_ARATH Transmembrane emp24 domain-containing protein p24delta10 OS=Arabidopsis thaliana GN=At1g69460 PE=1 SV=1 121 217 1.0E-07
sp|O81045|P24D8_ARATH Transmembrane emp24 domain-containing protein p24delta8 OS=Arabidopsis thaliana GN=At2g03290 PE=1 SV=1 120 217 1.0E-07
sp|P27869|TMD11_CANLF Transmembrane emp24 domain-containing protein 11 OS=Canis lupus familiaris GN=TMED11 PE=1 SV=1 19 217 4.0E-07
sp|O14324|YB79_SCHPO Uncharacterized membrane protein C16E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.09c PE=3 SV=1 54 217 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 188 207 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|703400
MYSLLFALFSLVALVPQQALGIKFSLPAYRYPSSKCIWNAAHPDTLVIVTANVVIGQNQRVDIEIVDSSPQKNVY
LSKRGIKAETRLAITTHGEGEVGVCLKNYLEGDVSSNVASKLASVVDLDVDIGADAVDYNAIANQESLSSLETEM
RKLEGVVKEIVDEMEYLKKRETRFTSTNTSTNDRVQNFAWFSIFSLAALGVWQVLHLRSYFKRKYLID*
Coding >Agabi119p4|703400
ATGTATTCTCTCCTCTTCGCGCTCTTTTCCCTTGTGGCCCTTGTTCCCCAGCAAGCTCTGGGCATAAAATTTTCT
TTACCGGCGTACCGATACCCTTCGTCAAAGTGCATATGGAATGCAGCACATCCGGACACGCTGGTAATCGTGACA
GCAAACGTGGTTATTGGCCAGAACCAGAGGGTGGATATTGAAATCGTGGATTCGTCACCGCAGAAGAATGTCTAT
CTGAGCAAGCGGGGGATTAAAGCTGAGACGAGGTTGGCTATTACGACGCATGGAGAGGGCGAGGTTGGGGTTTGT
TTGAAGAATTATTTGGAGGGTGATGTGTCGTCGAATGTTGCATCCAAGCTGGCGAGCGTCGTGGATTTGGACGTG
GATATTGGCGCTGATGCTGTCGACTACAATGCCATTGCGAACCAGGAGTCGCTGTCGAGCCTCGAAACCGAGATG
CGGAAGCTGGAAGGCGTGGTGAAGGAGATTGTGGACGAGATGGAGTACCTCAAGAAACGAGAGACTCGCTTTACC
TCCACCAACACCTCTACAAACGACCGTGTGCAAAACTTTGCCTGGTTCTCTATTTTCTCTCTTGCCGCGCTCGGT
GTATGGCAGGTTCTGCATCTGCGCTCCTACTTTAAACGCAAGTACCTCATCGACTAG
Transcript >Agabi119p4|703400
ATGTATTCTCTCCTCTTCGCGCTCTTTTCCCTTGTGGCCCTTGTTCCCCAGCAAGCTCTGGGCATAAAATTTTCT
TTACCGGCGTACCGATACCCTTCGTCAAAGTGCATATGGAATGCAGCACATCCGGACACGCTGGTAATCGTGACA
GCAAACGTGGTTATTGGCCAGAACCAGAGGGTGGATATTGAAATCGTGGATTCGTCACCGCAGAAGAATGTCTAT
CTGAGCAAGCGGGGGATTAAAGCTGAGACGAGGTTGGCTATTACGACGCATGGAGAGGGCGAGGTTGGGGTTTGT
TTGAAGAATTATTTGGAGGGTGATGTGTCGTCGAATGTTGCATCCAAGCTGGCGAGCGTCGTGGATTTGGACGTG
GATATTGGCGCTGATGCTGTCGACTACAATGCCATTGCGAACCAGGAGTCGCTGTCGAGCCTCGAAACCGAGATG
CGGAAGCTGGAAGGCGTGGTGAAGGAGATTGTGGACGAGATGGAGTACCTCAAGAAACGAGAGACTCGCTTTACC
TCCACCAACACCTCTACAAACGACCGTGTGCAAAACTTTGCCTGGTTCTCTATTTTCTCTCTTGCCGCGCTCGGT
GTATGGCAGGTTCTGCATCTGCGCTCCTACTTTAAACGCAAGTACCTCATCGACTAG
Gene >Agabi119p4|703400
ATGTATTCTCTCCTCTTCGCGCTCTTTTCCCTTGTGGCCCTTGTTCCCCAGCAAGCTCTGGGCATAAAATTTTCT
TTACCGGCGTACCGATACCCTTCGTCAAAGTGCATATGGAATGCAGCACATCCGGACACGCTGGTAATCGTGACA
GCAAACGTGGTTATTGGCCAGAACCAGAGGGTGGATATTGAAATCGTGGATTCGTCACCGCAGAAGAATGTCTAT
CTGAGCAAGCGGGGGATTAAAGCTGAGACGAGGTTGGCTATTACGACGCATGGAGAGGGCGAGGTTGGGGTTTGT
TTGAAGAATTATTTGGAGGGTGGTGAGTCGCCTCGAGGATTTCAAAGTAAATCATGCTGAGCGTCTATTGTAGAT
GTGTCGTCGAATGTTGCATCCAAGCTGGCGAGCGTCGTGGATTTGGACGTGGATATTGGCGCTGATGCTGTCGAC
TACAAGTAGGTGTCCGTGTAGGCCGTGTGTTACATGTGCTGATGGAAATGTGTGCCAGTGCCATTGCGAACCAGG
AGTCGCTGTCGAGCCTCGAAACCGAGATGCGGAAGCTGGAAGGCGTGGTGAAGGAGATTGTGGACGAGATGGAGT
ACCTCAAGAAACGAGAGACTCGCTTTACCTCCACCAACAGTACGCTATGTCTTTTTCCGCCTAGTGGCTGTTTCC
TCACCGGTTTTCCCCAGCCTCTACAAACGACCGTGTGCAAAACTTTGCCTGGTTCTCTATTTTCTCTCTTGCCGC
GCTCGGTGTATGGCAGGTTCTGCATCTGCGCTCCTACTTTAAACGCAAGTACCTCATCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail