Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|703250
Gene name
Locationscaffold_08:1390250..1391188
Strand-
Gene length (bp)938
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09177 Syntaxin-6_N Syntaxin 6, N-terminal 2.2E-25 4 102
PF05739 SNARE SNARE domain 1.4E-08 183 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Q2|STX6_PONAB Syntaxin-6 OS=Pongo abelii GN=STX6 PE=2 SV=1 4 222 3.0E-22
sp|O43752|STX6_HUMAN Syntaxin-6 OS=Homo sapiens GN=STX6 PE=1 SV=1 4 222 3.0E-22
sp|Q5ZL19|STX6_CHICK Syntaxin-6 OS=Gallus gallus GN=STX6 PE=2 SV=1 4 221 7.0E-22
sp|Q63635|STX6_RAT Syntaxin-6 OS=Rattus norvegicus GN=Stx6 PE=1 SV=1 4 222 2.0E-21
sp|Q9JKK1|STX6_MOUSE Syntaxin-6 OS=Mus musculus GN=Stx6 PE=1 SV=1 4 222 3.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Q2|STX6_PONAB Syntaxin-6 OS=Pongo abelii GN=STX6 PE=2 SV=1 4 222 3.0E-22
sp|O43752|STX6_HUMAN Syntaxin-6 OS=Homo sapiens GN=STX6 PE=1 SV=1 4 222 3.0E-22
sp|Q5ZL19|STX6_CHICK Syntaxin-6 OS=Gallus gallus GN=STX6 PE=2 SV=1 4 221 7.0E-22
sp|Q63635|STX6_RAT Syntaxin-6 OS=Rattus norvegicus GN=Stx6 PE=1 SV=1 4 222 2.0E-21
sp|Q9JKK1|STX6_MOUSE Syntaxin-6 OS=Mus musculus GN=Stx6 PE=1 SV=1 4 222 3.0E-21
sp|Q946Y7|SYP61_ARATH Syntaxin-61 OS=Arabidopsis thaliana GN=SYP61 PE=1 SV=1 4 238 2.0E-20
sp|Q9HGN3|TLG1_SCHPO t-SNARE affecting a late Golgi compartment protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlg1 PE=3 SV=1 4 223 2.0E-18
sp|O60499|STX10_HUMAN Syntaxin-10 OS=Homo sapiens GN=STX10 PE=1 SV=1 4 222 4.0E-18
sp|Q03322|TLG1_YEAST T-SNARE affecting a late Golgi compartment protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TLG1 PE=1 SV=1 2 225 4.0E-07
sp|Q54IX6|STX8B_DICDI Probable syntaxin-8B OS=Dictyostelium discoideum GN=syn8B PE=3 SV=1 126 220 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0048193 Golgi vesicle transport Yes
GO:0016020 membrane Yes
GO:0016192 vesicle-mediated transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 216 238 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|703250
MSVDPYHAVQQELETSIQNAGQLLSSYQRIQNIARDDSEELSYARNELKATLTTLEADLEDLEESVKMVEATGAR
MFGLDDAEVMKRRKYIGHVRRELENMRGQVSVAAPKRLPQQSSGSATPVYPPSSRGTSRDDDQSAWAREEQQLMV
RQQDETMTSISGTLNTLNQQASLMGQEIGEHNELLDDLERGVDSTETKLGGAMQRMRKILRDSEEKGSGCCIIFL
IIVLMILLLAVILV*
Coding >Agabi119p4|703250
ATGTCAGTCGACCCATATCACGCCGTTCAGCAGGAACTAGAAACATCGATACAAAATGCAGGCCAGCTTCTCTCA
TCATACCAGCGCATTCAAAACATAGCTCGCGACGACAGCGAGGAGTTGTCCTATGCGCGGAACGAGCTCAAAGCT
ACGCTGACGACGCTGGAAGCAGATTTGGAAGACCTTGAGGAAAGCGTAAAGATGGTCGAAGCGACAGGTGCACGT
ATGTTTGGTTTGGACGATGCAGAAGTTATGAAACGGCGGAAGTATATTGGCCACGTACGACGAGAGCTCGAGAAC
ATGAGAGGGCAGGTTTCTGTAGCAGCCCCCAAGCGTCTACCACAGCAATCTTCTGGCTCTGCCACACCCGTATAC
CCACCTTCGTCTCGTGGTACTTCGCGAGACGATGATCAGTCCGCATGGGCAAGAGAAGAGCAACAACTAATGGTT
CGCCAACAAGATGAGACGATGACCTCTATATCGGGCACTTTGAATACCTTGAATCAGCAAGCAAGTCTCATGGGT
CAAGAGATTGGAGAGCATAACGAACTTCTGGATGACCTGGAACGTGGCGTCGACTCGACGGAAACTAAGCTTGGA
GGTGCAATGCAGCGTATGCGCAAAATTCTCCGAGACTCTGAAGAGAAAGGAAGCGGTTGCTGTATCATCTTCCTT
ATTATCGTCCTAATGATTCTTTTACTCGCCGTCATCCTTGTTTAA
Transcript >Agabi119p4|703250
ATGTCAGTCGACCCATATCACGCCGTTCAGCAGGAACTAGAAACATCGATACAAAATGCAGGCCAGCTTCTCTCA
TCATACCAGCGCATTCAAAACATAGCTCGCGACGACAGCGAGGAGTTGTCCTATGCGCGGAACGAGCTCAAAGCT
ACGCTGACGACGCTGGAAGCAGATTTGGAAGACCTTGAGGAAAGCGTAAAGATGGTCGAAGCGACAGGTGCACGT
ATGTTTGGTTTGGACGATGCAGAAGTTATGAAACGGCGGAAGTATATTGGCCACGTACGACGAGAGCTCGAGAAC
ATGAGAGGGCAGGTTTCTGTAGCAGCCCCCAAGCGTCTACCACAGCAATCTTCTGGCTCTGCCACACCCGTATAC
CCACCTTCGTCTCGTGGTACTTCGCGAGACGATGATCAGTCCGCATGGGCAAGAGAAGAGCAACAACTAATGGTT
CGCCAACAAGATGAGACGATGACCTCTATATCGGGCACTTTGAATACCTTGAATCAGCAAGCAAGTCTCATGGGT
CAAGAGATTGGAGAGCATAACGAACTTCTGGATGACCTGGAACGTGGCGTCGACTCGACGGAAACTAAGCTTGGA
GGTGCAATGCAGCGTATGCGCAAAATTCTCCGAGACTCTGAAGAGAAAGGAAGCGGTTGCTGTATCATCTTCCTT
ATTATCGTCCTAATGATTCTTTTACTCGCCGTCATCCTTGTTTAA
Gene >Agabi119p4|703250
ATGTCAGTCGACCCATATCACGCCGTTCAGCAGGAACTAGAAACATCGATACAAAATGCAGGCCAGCTTCTCTCA
TCATACCAGCGCATTCAAAACATAGCTCGCGACGACAGCGAGGAGTTGTCCTATGCGCGGAACGAGGTACGTCAT
CTCTAGCTGAAGAATCGTTGCTTCAACTAACGTTTGAGATCAGCTCAAAGCTACGCTGACGACGCTGGAAGCAGA
TTTGGAAGACCTTGAGGAAAGCGTAAAGTTCGTCCTTCTGTTCCTCATTCGCAATTCAATATTTACCCAATATCG
CTAGGATGGTCGAAGCGACAGGTGCACGTATGTTTGGTTTGGACGATGCAGAAGTTATGAAACGGCGGAAGTATA
TTGGCCACGTACGACGAGAGCTCGAGGTGCGTCGATATTTATGCGACCCAACTTTTCTTCTCGTGCTGATACTCT
CGTTTGCAAGTGAAGAACATGAGAGGGCAGGTTTCTGTAGCAGCCCCCAAGCGTCTACCACAGCAATCTTCTGGC
TCTGCCACACCCGTATACCCACCTTCGTCTCGTGGTACTTCGCGAGACGATGATCAGTCCGCATGGGCAAGAGAA
GAGCAACAACTAATGGTTCGCCAACAAGATGAGACGATGACCTCTATATCGGGCACTTTGAATACCTTGAATCAG
CAAGCAAGTCTCATGGGTCAAGAGATTGGAGAGCATAACGAGTACGAGATCACTGCCAATCCACTCTTATTGCCA
CTAACTTGAACCCCAGACTTCTGGATGACCTGGAACGTGGCGTCGACTCGACGGAAACTAAGCTTGGAGGTGCAA
TGCAGCGTATGCGCAAAATTCTCCGAGACTCTGAAGAGAAAGGAAGCGGTTGCTGTATCATCTTCCTTATTATCG
TCCTAATGATTCTTTTACTCGCCGTCATCCTTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail