Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|703050
Gene name
Locationscaffold_08:1352469..1352871
Strand+
Gene length (bp)402
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.995873

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup8726
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|111600
Agaricus bisporus var bisporus H97 AgabiH97|111600
Agaricus bisporus var burnettii H119p4 Agabi119p4|703050 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|703050
MYWRWNFAVVVLATLFMFAAAAPLGGNLTGVEIISTVVGEASAQLLPSSPDTVTTTPEEQPSFGIADYMSNLLRG
EGRKSSDQARRRPHTITRRRHP*
Coding >Agabi119p4|703050
ATGTATTGGAGATGGAATTTTGCTGTTGTGGTGCTGGCTACATTATTTATGTTCGCCGCGGCTGCTCCACTAGGG
GGAAATTTGACGGGAGTGGAAATCATATCGACGGTTGTTGGAGAGGCATCAGCACAATTACTACCATCATCACCG
GACACTGTAACAACGACACCGGAAGAGCAACCATCTTTTGGGATTGCTGATTATATGTCGAATCTATTGAGAGGA
GAGGGACGGAAATCATCTGATCAGGCACGGCGGCGGCCGCACACCATAACGCGGAGACGACACCCTTAG
Transcript >Agabi119p4|703050
ATGTATTGGAGATGGAATTTTGCTGTTGTGGTGCTGGCTACATTATTTATGTTCGCCGCGGCTGCTCCACTAGGG
GGAAATTTGACGGGAGTGGAAATCATATCGACGGTTGTTGGAGAGGCATCAGCACAATTACTACCATCATCACCG
GACACTGTAACAACGACACCGGAAGAGCAACCATCTTTTGGGATTGCTGATTATATGTCGAATCTATTGAGAGGA
GAGGGACGGAAATCATCTGATCAGGCACGGCGGCGGCCGCACACCATAACGCGGAGACGACACCCTTAG
Gene >Agabi119p4|703050
ATGTATTGGAGATGGAATTTTGCTGTTGTGGTGCTGGCTACATTATTTATGTTCGCCGCGGCTGCTCCACTAGGG
GGAAATTTGACGGGAGTGGAAATCATATCGACGGTTGTTGGAGAGGCATCAGCACAATTACTACCATCATCACCG
GACACTGTAACAACGACACCGGAAGAGCAACCATCTTTTGGGTGAGTGAGCTGGGACCTTTGCATAAGTTTTGTT
TTTTGATTGTTATTTGTAGGATTGCTGATTATATGTCGAATCTATTGAGAGGAGAGGGACGGAAATCATCTGATC
AGGCACGGCGGCGGCCGCACACCATAACGCGGAGACGACACCCTGTGAGTGTATTGTGTTGCCAGTGGGTGTGCT
CAGGAGACTGACATTTGTATGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail