Protein ID | Agabi119p4|699950 |
Gene name | |
Location | scaffold_08:933727..938141 |
Strand | - |
Gene length (bp) | 4414 |
Transcript length (bp) | 3660 |
Coding sequence length (bp) | 3660 |
Protein length (aa) | 1220 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF04053 | Coatomer_WDAD | Coatomer WD associated region | 5.7E-138 | 347 | 776 |
PF06957 | COPI_C | Coatomer (COPI) alpha subunit C-terminus | 7.6E-105 | 866 | 1215 |
PF00400 | WD40 | WD domain, G-beta repeat | 2.1E-01 | 13 | 40 |
PF00400 | WD40 | WD domain, G-beta repeat | 1.5E-05 | 49 | 82 |
PF00400 | WD40 | WD domain, G-beta repeat | 2.3E-07 | 89 | 126 |
PF00400 | WD40 | WD domain, G-beta repeat | 2.9E-07 | 130 | 168 |
PF00400 | WD40 | WD domain, G-beta repeat | 5.8E-03 | 207 | 240 |
PF00400 | WD40 | WD domain, G-beta repeat | 1.9E-06 | 250 | 285 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 4 | 1215 | 0.0E+00 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 4 | 1215 | 0.0E+00 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 4 | 1215 | 0.0E+00 |
sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 4 | 1214 | 0.0E+00 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 4 | 1215 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 4 | 1215 | 0.0E+00 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 4 | 1215 | 0.0E+00 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 4 | 1215 | 0.0E+00 |
sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 4 | 1214 | 0.0E+00 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 4 | 1215 | 0.0E+00 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 4 | 1215 | 0.0E+00 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 4 | 1215 | 0.0E+00 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 4 | 1215 | 0.0E+00 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 4 | 1215 | 0.0E+00 |
sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 4 | 1215 | 0.0E+00 |
sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 4 | 1215 | 0.0E+00 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 7 | 773 | 5.0E-79 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 7 | 773 | 6.0E-79 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 7 | 773 | 6.0E-79 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 7 | 773 | 1.0E-78 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 7 | 773 | 1.0E-78 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 7 | 773 | 1.0E-77 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 7 | 794 | 6.0E-73 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 7 | 809 | 7.0E-73 |
sp|O42937|COPB2_SCHPO | Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec27 PE=3 SV=2 | 7 | 780 | 8.0E-73 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 7 | 809 | 1.0E-72 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 7 | 900 | 6.0E-71 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 7 | 923 | 2.0E-70 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 7 | 923 | 6.0E-70 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 7 | 809 | 8.0E-70 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 7 | 773 | 7.0E-69 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 7 | 737 | 5.0E-65 |
sp|P41811|COPB2_YEAST | Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1 | 8 | 754 | 2.0E-63 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 5 | 317 | 6.0E-39 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 8 | 295 | 4.0E-37 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 5 | 356 | 2.0E-36 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 2 | 298 | 1.0E-35 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 8 | 323 | 7.0E-34 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 5 | 296 | 8.0E-34 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 8 | 295 | 6.0E-33 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 3 | 286 | 8.0E-33 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 8 | 323 | 5.0E-32 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 15 | 561 | 6.0E-32 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 5 | 327 | 2.0E-31 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 5 | 316 | 4.0E-31 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 18 | 287 | 2.0E-30 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 19 | 549 | 3.0E-30 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 5 | 316 | 1.0E-29 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 7 | 302 | 3.0E-29 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 7 | 316 | 3.0E-29 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 3 | 374 | 6.0E-29 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 7 | 241 | 1.0E-28 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 8 | 284 | 1.0E-28 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 7 | 285 | 1.0E-28 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 15 | 284 | 3.0E-28 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 53 | 295 | 3.0E-28 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 15 | 285 | 5.0E-28 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 20 | 285 | 6.0E-28 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 13 | 328 | 7.0E-28 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 15 | 284 | 7.0E-28 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 15 | 284 | 7.0E-28 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 7 | 284 | 3.0E-27 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 7 | 285 | 3.0E-27 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 7 | 285 | 3.0E-27 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 7 | 285 | 3.0E-27 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 18 | 285 | 5.0E-27 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 7 | 285 | 5.0E-27 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 7 | 285 | 5.0E-27 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 18 | 285 | 6.0E-27 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 47 | 317 | 6.0E-27 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 53 | 295 | 9.0E-27 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 15 | 285 | 1.0E-26 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 18 | 285 | 1.0E-26 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 53 | 302 | 1.0E-26 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 20 | 286 | 2.0E-26 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 18 | 285 | 2.0E-26 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 18 | 285 | 2.0E-26 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 18 | 285 | 2.0E-26 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 15 | 295 | 2.0E-26 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 7 | 241 | 2.0E-26 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 7 | 241 | 2.0E-26 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 15 | 302 | 3.0E-26 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 53 | 295 | 4.0E-26 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 15 | 284 | 5.0E-26 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 15 | 285 | 5.0E-26 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 7 | 241 | 5.0E-26 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 18 | 285 | 6.0E-26 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 15 | 286 | 8.0E-26 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 15 | 286 | 8.0E-26 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 53 | 295 | 8.0E-26 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 8 | 286 | 1.0E-25 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 15 | 285 | 1.0E-25 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 53 | 302 | 1.0E-25 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 18 | 287 | 2.0E-25 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 15 | 302 | 2.0E-25 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 15 | 285 | 2.0E-25 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 15 | 317 | 2.0E-25 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 53 | 302 | 2.0E-25 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 15 | 317 | 2.0E-25 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 18 | 287 | 2.0E-25 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 15 | 285 | 3.0E-25 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 53 | 302 | 3.0E-25 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 12 | 285 | 4.0E-25 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 20 | 286 | 4.0E-25 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 53 | 302 | 5.0E-25 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 53 | 302 | 5.0E-25 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 8 | 284 | 5.0E-25 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 53 | 302 | 5.0E-25 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 53 | 302 | 5.0E-25 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 53 | 302 | 5.0E-25 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 15 | 285 | 6.0E-25 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 53 | 302 | 6.0E-25 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 53 | 295 | 7.0E-25 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 53 | 302 | 7.0E-25 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 68 | 331 | 8.0E-25 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 68 | 331 | 8.0E-25 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 15 | 285 | 9.0E-25 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 25 | 292 | 9.0E-25 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 15 | 284 | 1.0E-24 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 7 | 284 | 1.0E-24 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 53 | 302 | 1.0E-24 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 15 | 284 | 1.0E-24 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 15 | 284 | 1.0E-24 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 60 | 323 | 2.0E-24 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 8 | 285 | 2.0E-24 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 12 | 285 | 2.0E-24 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 15 | 285 | 2.0E-24 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 15 | 285 | 2.0E-24 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 15 | 285 | 2.0E-24 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 15 | 285 | 2.0E-24 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 46 | 317 | 2.0E-24 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 8 | 287 | 2.0E-24 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 12 | 284 | 2.0E-24 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 15 | 317 | 2.0E-24 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 15 | 317 | 2.0E-24 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 15 | 317 | 2.0E-24 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 15 | 317 | 2.0E-24 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 15 | 285 | 3.0E-24 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 15 | 285 | 3.0E-24 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 15 | 285 | 4.0E-24 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 15 | 285 | 4.0E-24 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 50 | 359 | 5.0E-24 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 15 | 285 | 6.0E-24 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 13 | 302 | 6.0E-24 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 53 | 319 | 6.0E-24 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 68 | 331 | 7.0E-24 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 5 | 309 | 8.0E-24 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 8 | 299 | 9.0E-24 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 15 | 317 | 9.0E-24 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 15 | 317 | 9.0E-24 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 8 | 317 | 1.0E-23 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 12 | 284 | 1.0E-23 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 8 | 284 | 1.0E-23 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 50 | 328 | 2.0E-23 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 26 | 284 | 2.0E-23 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 18 | 287 | 2.0E-23 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 15 | 316 | 2.0E-23 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 23 | 301 | 2.0E-23 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 5 | 317 | 3.0E-23 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 53 | 288 | 3.0E-23 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 15 | 286 | 3.0E-23 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 8 | 302 | 3.0E-23 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 8 | 302 | 3.0E-23 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 4 | 509 | 5.0E-23 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 8 | 302 | 5.0E-23 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 53 | 295 | 6.0E-23 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 20 | 387 | 6.0E-23 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 8 | 284 | 6.0E-23 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 7 | 284 | 6.0E-23 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 68 | 337 | 7.0E-23 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 8 | 331 | 9.0E-23 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 50 | 359 | 1.0E-22 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 53 | 295 | 1.0E-22 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 15 | 183 | 1.0E-22 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 15 | 183 | 1.0E-22 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 68 | 288 | 1.0E-22 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 19 | 296 | 1.0E-22 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 3 | 317 | 2.0E-22 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 15 | 285 | 2.0E-22 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 50 | 295 | 3.0E-22 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 50 | 295 | 3.0E-22 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 50 | 337 | 3.0E-22 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 7 | 316 | 3.0E-22 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 2 | 244 | 3.0E-22 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 2 | 244 | 3.0E-22 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 3 | 317 | 4.0E-22 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 8 | 287 | 6.0E-22 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 15 | 169 | 6.0E-22 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 50 | 337 | 7.0E-22 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 53 | 295 | 8.0E-22 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 5 | 284 | 8.0E-22 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 90 | 323 | 1.0E-21 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 53 | 295 | 1.0E-21 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 50 | 337 | 1.0E-21 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 15 | 183 | 1.0E-21 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 40 | 317 | 1.0E-21 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 5 | 317 | 1.0E-21 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 53 | 295 | 2.0E-21 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 24 | 317 | 2.0E-21 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 15 | 284 | 2.0E-21 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 8 | 241 | 2.0E-21 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 15 | 323 | 2.0E-21 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 8 | 331 | 2.0E-21 |
sp|Q6CG48|LIS1_YARLI | Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 | 15 | 288 | 2.0E-21 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 53 | 295 | 3.0E-21 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 53 | 295 | 3.0E-21 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 8 | 326 | 3.0E-21 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 14 | 284 | 3.0E-21 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 14 | 284 | 3.0E-21 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 15 | 169 | 3.0E-21 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 53 | 295 | 4.0E-21 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 53 | 295 | 4.0E-21 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 25 | 288 | 4.0E-21 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 53 | 302 | 5.0E-21 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 8 | 334 | 5.0E-21 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 53 | 317 | 6.0E-21 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 48 | 514 | 7.0E-21 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 7 | 284 | 8.0E-21 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 8 | 302 | 8.0E-21 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 15 | 169 | 9.0E-21 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 7 | 289 | 1.0E-20 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 8 | 326 | 1.0E-20 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 53 | 302 | 1.0E-20 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 8 | 241 | 1.0E-20 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 8 | 317 | 1.0E-20 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 5 | 284 | 1.0E-20 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 15 | 169 | 2.0E-20 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 12 | 289 | 2.0E-20 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 46 | 317 | 2.0E-20 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 8 | 241 | 3.0E-20 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 51 | 327 | 3.0E-20 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 8 | 241 | 4.0E-20 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 8 | 302 | 4.0E-20 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 53 | 302 | 7.0E-20 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 26 | 284 | 8.0E-20 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 26 | 284 | 8.0E-20 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 51 | 327 | 8.0E-20 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 51 | 327 | 8.0E-20 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 15 | 265 | 8.0E-20 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 5 | 284 | 8.0E-20 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 8 | 302 | 8.0E-20 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 2 | 240 | 1.0E-19 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 53 | 302 | 2.0E-19 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 3 | 296 | 2.0E-19 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 53 | 325 | 2.0E-19 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 3 | 305 | 2.0E-19 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 51 | 327 | 2.0E-19 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 51 | 327 | 2.0E-19 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 13 | 240 | 3.0E-19 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 13 | 240 | 3.0E-19 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 81 | 363 | 3.0E-19 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 50 | 359 | 3.0E-19 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 8 | 267 | 3.0E-19 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 45 | 334 | 3.0E-19 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 45 | 340 | 4.0E-19 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 10 | 317 | 4.0E-19 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 2 | 240 | 4.0E-19 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 57 | 326 | 4.0E-19 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 66 | 326 | 4.0E-19 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 51 | 327 | 4.0E-19 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 45 | 340 | 5.0E-19 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 7 | 244 | 5.0E-19 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 7 | 244 | 5.0E-19 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 51 | 327 | 5.0E-19 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 12 | 181 | 6.0E-19 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 51 | 327 | 6.0E-19 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 8 | 244 | 6.0E-19 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 8 | 244 | 6.0E-19 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 5 | 173 | 7.0E-19 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 8 | 244 | 8.0E-19 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 8 | 170 | 9.0E-19 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 13 | 240 | 9.0E-19 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 15 | 168 | 9.0E-19 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 8 | 244 | 9.0E-19 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 26 | 286 | 9.0E-19 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 96 | 337 | 1.0E-18 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 1 | 240 | 1.0E-18 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 94 | 296 | 1.0E-18 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 8 | 345 | 1.0E-18 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 13 | 289 | 1.0E-18 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 50 | 288 | 1.0E-18 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 8 | 257 | 1.0E-18 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 51 | 327 | 1.0E-18 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 13 | 240 | 2.0E-18 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 13 | 240 | 2.0E-18 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 13 | 240 | 2.0E-18 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 8 | 257 | 2.0E-18 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 51 | 327 | 2.0E-18 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 51 | 327 | 2.0E-18 |
sp|Q6CGP9|PFS2_YARLI | Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1 | 4 | 296 | 2.0E-18 |
sp|B4GDM7|CIAO1_DROPE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 | 45 | 367 | 2.0E-18 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 8 | 257 | 2.0E-18 |
sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 45 | 284 | 2.0E-18 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 94 | 296 | 3.0E-18 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 8 | 284 | 3.0E-18 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 82 | 397 | 3.0E-18 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 2 | 288 | 3.0E-18 |
sp|Q292E8|CIAO1_DROPS | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 | 45 | 367 | 3.0E-18 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 8 | 257 | 3.0E-18 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 15 | 159 | 3.0E-18 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 53 | 325 | 3.0E-18 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 92 | 331 | 4.0E-18 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 8 | 169 | 4.0E-18 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 15 | 159 | 4.0E-18 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 5 | 333 | 4.0E-18 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 35 | 293 | 4.0E-18 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 13 | 240 | 5.0E-18 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 8 | 257 | 5.0E-18 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 8 | 257 | 5.0E-18 |
sp|O80990|CIA1_ARATH | Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 | 9 | 243 | 5.0E-18 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 53 | 302 | 5.0E-18 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 40 | 288 | 6.0E-18 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 45 | 284 | 6.0E-18 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 45 | 353 | 6.0E-18 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 8 | 244 | 6.0E-18 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 40 | 280 | 7.0E-18 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 8 | 168 | 7.0E-18 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 68 | 336 | 8.0E-18 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 15 | 302 | 8.0E-18 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 15 | 170 | 9.0E-18 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 5 | 278 | 1.0E-17 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 40 | 335 | 1.0E-17 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 15 | 284 | 1.0E-17 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 22 | 194 | 1.0E-17 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 53 | 316 | 2.0E-17 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 94 | 330 | 2.0E-17 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 94 | 330 | 2.0E-17 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 45 | 327 | 2.0E-17 |
sp|A5DJX5|LIS1_PICGU | Nuclear distribution protein PAC1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAC1 PE=3 SV=2 | 15 | 287 | 2.0E-17 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 53 | 295 | 2.0E-17 |
sp|A5D7H2|STRN3_BOVIN | Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 | 15 | 325 | 2.0E-17 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 8 | 244 | 2.0E-17 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 53 | 295 | 2.0E-17 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 45 | 330 | 2.0E-17 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 15 | 295 | 2.0E-17 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 53 | 344 | 3.0E-17 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 42 | 292 | 3.0E-17 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 46 | 317 | 3.0E-17 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 8 | 244 | 3.0E-17 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 15 | 284 | 3.0E-17 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 46 | 284 | 3.0E-17 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 8 | 244 | 3.0E-17 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 45 | 327 | 3.0E-17 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 8 | 244 | 3.0E-17 |
sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 45 | 368 | 3.0E-17 |
sp|O80990|CIA1_ARATH | Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 | 3 | 240 | 4.0E-17 |
sp|C4R6H3|LIS1_PICPG | Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 | 15 | 285 | 4.0E-17 |
sp|O55106|STRN_MOUSE | Striatin OS=Mus musculus GN=Strn PE=1 SV=2 | 15 | 325 | 4.0E-17 |
sp|Q5A7Q3|PRP46_CANAL | Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 | 15 | 284 | 4.0E-17 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 94 | 296 | 4.0E-17 |
sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 8 | 290 | 4.0E-17 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 45 | 330 | 5.0E-17 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 22 | 286 | 5.0E-17 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 26 | 235 | 5.0E-17 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 69 | 286 | 5.0E-17 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 49 | 344 | 6.0E-17 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 49 | 344 | 6.0E-17 |
sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 45 | 284 | 6.0E-17 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 35 | 290 | 6.0E-17 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 26 | 284 | 7.0E-17 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 15 | 284 | 7.0E-17 |
sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 21 | 284 | 7.0E-17 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 94 | 330 | 7.0E-17 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 94 | 330 | 7.0E-17 |
sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 45 | 368 | 7.0E-17 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 42 | 292 | 8.0E-17 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 53 | 317 | 8.0E-17 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 15 | 194 | 8.0E-17 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 8 | 244 | 8.0E-17 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 53 | 325 | 8.0E-17 |
sp|B4JW81|CIAO1_DROGR | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 | 45 | 368 | 8.0E-17 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 94 | 329 | 1.0E-16 |
sp|P58405|STRN3_RAT | Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=1 SV=2 | 15 | 325 | 1.0E-16 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 2 | 306 | 1.0E-16 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 8 | 244 | 1.0E-16 |
sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 15 | 284 | 1.0E-16 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 45 | 327 | 1.0E-16 |
sp|Q9ERG2|STRN3_MOUSE | Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 | 15 | 325 | 1.0E-16 |
sp|B3MC74|CIAO1_DROAN | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 | 50 | 334 | 1.0E-16 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 26 | 235 | 1.0E-16 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 45 | 327 | 1.0E-16 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 45 | 340 | 2.0E-16 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 96 | 337 | 2.0E-16 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 96 | 337 | 2.0E-16 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 26 | 284 | 2.0E-16 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 94 | 323 | 2.0E-16 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 39 | 288 | 2.0E-16 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 69 | 403 | 2.0E-16 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 35 | 286 | 2.0E-16 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 8 | 257 | 2.0E-16 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 53 | 323 | 2.0E-16 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 45 | 327 | 2.0E-16 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 45 | 327 | 2.0E-16 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 45 | 327 | 2.0E-16 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 53 | 327 | 2.0E-16 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 26 | 235 | 2.0E-16 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 35 | 242 | 2.0E-16 |
sp|B0XAF3|CIAO1_CULQU | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 | 3 | 241 | 2.0E-16 |
sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 7 | 326 | 2.0E-16 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 5 | 284 | 2.0E-16 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 35 | 242 | 2.0E-16 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 9 | 240 | 3.0E-16 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 8 | 168 | 3.0E-16 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 18 | 317 | 3.0E-16 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 69 | 295 | 3.0E-16 |
sp|O43815|STRN_HUMAN | Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 | 15 | 325 | 3.0E-16 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 26 | 244 | 3.0E-16 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 35 | 240 | 3.0E-16 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 18 | 317 | 4.0E-16 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 15 | 244 | 4.0E-16 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 53 | 325 | 4.0E-16 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 69 | 295 | 4.0E-16 |
sp|P70483|STRN_RAT | Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 | 15 | 325 | 4.0E-16 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 53 | 169 | 4.0E-16 |
sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 53 | 325 | 4.0E-16 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 15 | 286 | 4.0E-16 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 106 | 323 | 5.0E-16 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 81 | 397 | 5.0E-16 |
sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 45 | 284 | 5.0E-16 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 8 | 257 | 5.0E-16 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 5 | 240 | 6.0E-16 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 13 | 240 | 6.0E-16 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 92 | 317 | 6.0E-16 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 13 | 242 | 6.0E-16 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 18 | 241 | 7.0E-16 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 5 | 284 | 7.0E-16 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 53 | 325 | 7.0E-16 |
sp|P58404|STRN4_MOUSE | Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 | 8 | 325 | 7.0E-16 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 53 | 325 | 8.0E-16 |
sp|Q5A7Q3|PRP46_CANAL | Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 | 53 | 325 | 8.0E-16 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 6 | 344 | 8.0E-16 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 53 | 299 | 8.0E-16 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 50 | 336 | 8.0E-16 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 6 | 344 | 9.0E-16 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 26 | 286 | 1.0E-15 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 36 | 241 | 1.0E-15 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 53 | 302 | 1.0E-15 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 83 | 327 | 1.0E-15 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 15 | 170 | 1.0E-15 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 8 | 290 | 1.0E-15 |
sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 13 | 242 | 1.0E-15 |
sp|B6K1G6|CFD1_SCHJY | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 | 2 | 171 | 1.0E-15 |
sp|Q9Y2I8|WDR37_HUMAN | WD repeat-containing protein 37 OS=Homo sapiens GN=WDR37 PE=1 SV=2 | 95 | 298 | 1.0E-15 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 3 | 243 | 1.0E-15 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 69 | 317 | 1.0E-15 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 13 | 240 | 2.0E-15 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 26 | 284 | 2.0E-15 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 19 | 344 | 2.0E-15 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 53 | 325 | 2.0E-15 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 53 | 302 | 2.0E-15 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 13 | 169 | 2.0E-15 |
sp|Q5R650|WDR37_PONAB | WD repeat-containing protein 37 OS=Pongo abelii GN=WDR37 PE=2 SV=1 | 95 | 298 | 2.0E-15 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 53 | 286 | 2.0E-15 |
sp|Q13033|STRN3_HUMAN | Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 | 15 | 325 | 2.0E-15 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 15 | 284 | 2.0E-15 |
sp|B3RNR8|CIAO1_TRIAD | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 | 51 | 323 | 2.0E-15 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 26 | 295 | 3.0E-15 |
sp|Q4I7X1|PFS2_GIBZE | Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 | 8 | 262 | 3.0E-15 |
sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 13 | 242 | 3.0E-15 |
sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 45 | 336 | 3.0E-15 |
sp|A4IIX9|WDR37_XENTR | WD repeat-containing protein 37 OS=Xenopus tropicalis GN=wdr37 PE=2 SV=1 | 44 | 298 | 3.0E-15 |
sp|Q8CBE3|WDR37_MOUSE | WD repeat-containing protein 37 OS=Mus musculus GN=Wdr37 PE=1 SV=1 | 44 | 298 | 3.0E-15 |
sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 7 | 284 | 3.0E-15 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 113 | 300 | 3.0E-15 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 8 | 185 | 3.0E-15 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 60 | 325 | 3.0E-15 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 18 | 250 | 3.0E-15 |
sp|Q7K1Y4|CIAO1_DROME | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 | 45 | 284 | 3.0E-15 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 8 | 257 | 3.0E-15 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 20 | 244 | 3.0E-15 |
sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 45 | 284 | 3.0E-15 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 92 | 344 | 4.0E-15 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 53 | 356 | 4.0E-15 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 8 | 302 | 4.0E-15 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 100 | 317 | 4.0E-15 |
sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 45 | 284 | 4.0E-15 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 21 | 242 | 4.0E-15 |
sp|Q6DDF0|WDR37_XENLA | WD repeat-containing protein 37 OS=Xenopus laevis GN=wdr37 PE=2 SV=1 | 44 | 298 | 4.0E-15 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 15 | 295 | 4.0E-15 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 7 | 323 | 4.0E-15 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 4 | 167 | 5.0E-15 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 42 | 284 | 5.0E-15 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 53 | 302 | 5.0E-15 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 12 | 175 | 5.0E-15 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 21 | 242 | 5.0E-15 |
sp|B9WD30|LIS1_CANDC | Nuclear distribution protein PAC1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PAC1 PE=3 SV=1 | 54 | 287 | 5.0E-15 |
sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 45 | 284 | 5.0E-15 |
sp|C4YPI7|LIS1_CANAW | Nuclear distribution protein PAC1 OS=Candida albicans (strain WO-1) GN=PAC1 PE=3 SV=1 | 54 | 358 | 5.0E-15 |
sp|Q5A7Q6|LIS1_CANAL | Nuclear distribution protein PAC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAC1 PE=3 SV=1 | 54 | 358 | 5.0E-15 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 15 | 295 | 5.0E-15 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 5 | 142 | 6.0E-15 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 18 | 317 | 6.0E-15 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 7 | 170 | 6.0E-15 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 7 | 170 | 6.0E-15 |
sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 53 | 284 | 6.0E-15 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 53 | 325 | 6.0E-15 |
sp|Q9W5Z5|WSB1_TAKRU | WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 | 20 | 291 | 6.0E-15 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 69 | 330 | 6.0E-15 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 6 | 344 | 6.0E-15 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 45 | 330 | 6.0E-15 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 60 | 325 | 6.0E-15 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 92 | 364 | 7.0E-15 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 5 | 240 | 7.0E-15 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 1 | 317 | 7.0E-15 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 51 | 288 | 7.0E-15 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 81 | 300 | 8.0E-15 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 81 | 300 | 8.0E-15 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 81 | 300 | 8.0E-15 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 81 | 300 | 8.0E-15 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 92 | 364 | 8.0E-15 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 4 | 240 | 8.0E-15 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 50 | 302 | 8.0E-15 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 83 | 317 | 9.0E-15 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 8 | 185 | 9.0E-15 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 7 | 323 | 9.0E-15 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 8 | 185 | 9.0E-15 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 7 | 323 | 9.0E-15 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 7 | 323 | 9.0E-15 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 7 | 323 | 9.0E-15 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 7 | 323 | 9.0E-15 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 8 | 267 | 9.0E-15 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 81 | 300 | 1.0E-14 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 81 | 300 | 1.0E-14 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 81 | 300 | 1.0E-14 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 13 | 240 | 1.0E-14 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 13 | 240 | 1.0E-14 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 92 | 344 | 1.0E-14 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 92 | 300 | 1.0E-14 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 92 | 300 | 1.0E-14 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 92 | 300 | 1.0E-14 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 92 | 300 | 1.0E-14 |
sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 13 | 242 | 1.0E-14 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 69 | 325 | 1.0E-14 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 15 | 299 | 1.0E-14 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 39 | 295 | 1.0E-14 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 12 | 258 | 1.0E-14 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 69 | 328 | 1.0E-14 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 8 | 185 | 1.0E-14 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 69 | 328 | 1.0E-14 |
sp|Q9NRL3|STRN4_HUMAN | Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 | 8 | 325 | 1.0E-14 |
sp|Q17GR9|CIAO1_AEDAE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 | 4 | 394 | 1.0E-14 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 67 | 309 | 1.0E-14 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 69 | 300 | 1.0E-14 |
sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 20 | 244 | 1.0E-14 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 69 | 300 | 1.0E-14 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 69 | 300 | 1.0E-14 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 15 | 240 | 1.0E-14 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 5 | 240 | 2.0E-14 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 79 | 357 | 2.0E-14 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 79 | 357 | 2.0E-14 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 79 | 357 | 2.0E-14 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 79 | 357 | 2.0E-14 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 79 | 357 | 2.0E-14 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 13 | 240 | 2.0E-14 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 79 | 357 | 2.0E-14 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 13 | 240 | 2.0E-14 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 79 | 357 | 2.0E-14 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 13 | 240 | 2.0E-14 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 79 | 357 | 2.0E-14 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 13 | 240 | 2.0E-14 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 13 | 240 | 2.0E-14 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 13 | 240 | 2.0E-14 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 93 | 344 | 2.0E-14 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 14 | 165 | 2.0E-14 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 18 | 240 | 2.0E-14 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 15 | 299 | 2.0E-14 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 15 | 299 | 2.0E-14 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 6 | 344 | 2.0E-14 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 69 | 300 | 2.0E-14 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 69 | 327 | 2.0E-14 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 5 | 288 | 2.0E-14 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 100 | 287 | 2.0E-14 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 100 | 287 | 2.0E-14 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 13 | 167 | 2.0E-14 |
sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 7 | 323 | 2.0E-14 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 5 | 295 | 2.0E-14 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 5 | 295 | 2.0E-14 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 7 | 323 | 2.0E-14 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 81 | 296 | 3.0E-14 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 79 | 357 | 3.0E-14 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 93 | 344 | 3.0E-14 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 94 | 329 | 3.0E-14 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 9 | 169 | 3.0E-14 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 68 | 310 | 3.0E-14 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 81 | 401 | 4.0E-14 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 79 | 357 | 4.0E-14 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 79 | 357 | 4.0E-14 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 96 | 321 | 4.0E-14 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 21 | 170 | 4.0E-14 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 15 | 257 | 4.0E-14 |
sp|Q5I0B9|ATG16_XENTR | Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 | 50 | 295 | 4.0E-14 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 5 | 286 | 4.0E-14 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 13 | 240 | 5.0E-14 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 15 | 169 | 5.0E-14 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 15 | 245 | 5.0E-14 |
sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 51 | 325 | 5.0E-14 |
sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 9 | 289 | 5.0E-14 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 8 | 295 | 5.0E-14 |
sp|Q75AV4|PFS2_ASHGO | Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 | 6 | 322 | 5.0E-14 |
sp|A3LNI7|LIS1_PICST | Nuclear distribution protein PAC1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAC1 PE=3 SV=2 | 8 | 287 | 5.0E-14 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 113 | 325 | 6.0E-14 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 4 | 167 | 6.0E-14 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 96 | 321 | 6.0E-14 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 15 | 169 | 6.0E-14 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 15 | 245 | 6.0E-14 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 6 | 241 | 7.0E-14 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 1 | 240 | 7.0E-14 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 4 | 274 | 7.0E-14 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 89 | 326 | 7.0E-14 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 15 | 172 | 7.0E-14 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 4 | 166 | 7.0E-14 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 15 | 167 | 7.0E-14 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 25 | 268 | 7.0E-14 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 81 | 300 | 8.0E-14 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 81 | 300 | 8.0E-14 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 53 | 347 | 8.0E-14 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 27 | 288 | 8.0E-14 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 6 | 344 | 8.0E-14 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 79 | 397 | 9.0E-14 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 33 | 296 | 9.0E-14 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 1 | 317 | 9.0E-14 |
sp|Q676U5|A16L1_HUMAN | Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 | 50 | 295 | 9.0E-14 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 81 | 300 | 1.0E-13 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 81 | 300 | 1.0E-13 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 79 | 357 | 1.0E-13 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 13 | 240 | 1.0E-13 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 7 | 297 | 1.0E-13 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 26 | 241 | 1.0E-13 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 15 | 245 | 1.0E-13 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 33 | 295 | 1.0E-13 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 15 | 241 | 1.0E-13 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 33 | 296 | 1.0E-13 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 33 | 296 | 1.0E-13 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 52 | 317 | 1.0E-13 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 9 | 171 | 1.0E-13 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 44 | 298 | 1.0E-13 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 8 | 295 | 1.0E-13 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 41 | 267 | 1.0E-13 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 8 | 257 | 1.0E-13 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 39 | 268 | 1.0E-13 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 93 | 287 | 2.0E-13 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 93 | 287 | 2.0E-13 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 81 | 300 | 2.0E-13 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 79 | 388 | 2.0E-13 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 79 | 397 | 2.0E-13 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 4 | 282 | 2.0E-13 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 15 | 244 | 2.0E-13 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 15 | 170 | 2.0E-13 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 15 | 170 | 2.0E-13 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 89 | 326 | 2.0E-13 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 1 | 317 | 2.0E-13 |
sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 35 | 281 | 2.0E-13 |
sp|Q5RAC9|A16L1_PONAB | Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 | 50 | 295 | 2.0E-13 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 8 | 257 | 2.0E-13 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 53 | 314 | 2.0E-13 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 53 | 337 | 3.0E-13 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 53 | 306 | 3.0E-13 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 92 | 300 | 3.0E-13 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 15 | 158 | 3.0E-13 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 3 | 288 | 3.0E-13 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 96 | 327 | 3.0E-13 |
sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 4 | 241 | 3.0E-13 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 1 | 286 | 3.0E-13 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 15 | 295 | 3.0E-13 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 70 | 292 | 3.0E-13 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 68 | 310 | 3.0E-13 |
sp|Q8C0J2|A16L1_MOUSE | Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 | 50 | 295 | 3.0E-13 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 4 | 167 | 4.0E-13 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 5 | 241 | 4.0E-13 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 98 | 397 | 4.0E-13 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 8 | 170 | 4.0E-13 |
sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 15 | 284 | 4.0E-13 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 15 | 245 | 4.0E-13 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 27 | 292 | 4.0E-13 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 33 | 240 | 4.0E-13 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 6 | 169 | 4.0E-13 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 6 | 169 | 4.0E-13 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 6 | 312 | 4.0E-13 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 94 | 315 | 5.0E-13 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 135 | 371 | 5.0E-13 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 19 | 171 | 5.0E-13 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 15 | 245 | 5.0E-13 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 96 | 327 | 5.0E-13 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 15 | 284 | 5.0E-13 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 12 | 180 | 5.0E-13 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 65 | 292 | 5.0E-13 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 33 | 174 | 5.0E-13 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 15 | 289 | 5.0E-13 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 15 | 289 | 5.0E-13 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 6 | 170 | 5.0E-13 |
sp|C5MJE8|LIS1_CANTT | Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 | 54 | 287 | 5.0E-13 |
sp|Q8W117|SMU1_ARATH | Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 | 7 | 168 | 5.0E-13 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 26 | 303 | 5.0E-13 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 26 | 298 | 6.0E-13 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 4 | 284 | 6.0E-13 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 4 | 284 | 6.0E-13 |
sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 46 | 341 | 6.0E-13 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 32 | 244 | 7.0E-13 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 35 | 170 | 7.0E-13 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 4 | 284 | 7.0E-13 |
sp|Q9T014|SPA2_ARATH | Protein SPA1-RELATED 2 OS=Arabidopsis thaliana GN=SPA2 PE=1 SV=2 | 27 | 286 | 7.0E-13 |
sp|P20484|MAK11_YEAST | Protein MAK11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK11 PE=1 SV=1 | 50 | 176 | 7.0E-13 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 4 | 284 | 8.0E-13 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 15 | 295 | 8.0E-13 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 15 | 152 | 8.0E-13 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 68 | 330 | 8.0E-13 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 5 | 169 | 9.0E-13 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 33 | 169 | 9.0E-13 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 50 | 328 | 9.0E-13 |
sp|Q15269|PWP2_HUMAN | Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 | 9 | 286 | 9.0E-13 |
sp|O94289|LUB1_SCHPO | Ubiquitin homeostasis protein lub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lub1 PE=1 SV=2 | 23 | 335 | 9.0E-13 |
sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 13 | 245 | 9.0E-13 |
sp|Q9FUY2|LEUNG_ARATH | Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 | 68 | 292 | 9.0E-13 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 13 | 240 | 1.0E-12 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 62 | 167 | 1.0E-12 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 53 | 325 | 1.0E-12 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 15 | 295 | 1.0E-12 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 18 | 284 | 1.0E-12 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 6 | 284 | 1.0E-12 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 64 | 326 | 1.0E-12 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 8 | 244 | 1.0E-12 |
sp|Q6CBI8|CIAO1_YARLI | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 | 4 | 167 | 1.0E-12 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 33 | 286 | 1.0E-12 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 8 | 284 | 1.0E-12 |
sp|Q9UT57|CFD1_SCHPO | Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 | 5 | 167 | 1.0E-12 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 81 | 284 | 2.0E-12 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 8 | 284 | 2.0E-12 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 23 | 284 | 2.0E-12 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 15 | 169 | 2.0E-12 |
sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 4 | 241 | 2.0E-12 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 65 | 292 | 2.0E-12 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 27 | 284 | 2.0E-12 |
sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 25 | 237 | 2.0E-12 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 51 | 327 | 2.0E-12 |
sp|Q28DW0|CIAO1_XENTR | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 | 60 | 284 | 2.0E-12 |
sp|Q20059|WDR48_CAEEL | WD repeat-containing protein 48 homolog OS=Caenorhabditis elegans GN=wdr-48 PE=1 SV=2 | 51 | 323 | 2.0E-12 |
sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 65 | 295 | 2.0E-12 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 68 | 288 | 2.0E-12 |
sp|Q2TZG4|PFS2_ASPOR | Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 | 32 | 281 | 2.0E-12 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 4 | 168 | 2.0E-12 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 93 | 331 | 2.0E-12 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 68 | 334 | 2.0E-12 |
sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 12 | 174 | 2.0E-12 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 50 | 330 | 2.0E-12 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 5 | 293 | 2.0E-12 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 53 | 319 | 2.0E-12 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 50 | 179 | 2.0E-12 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 6 | 241 | 3.0E-12 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 5 | 240 | 3.0E-12 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 5 | 167 | 3.0E-12 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 5 | 167 | 3.0E-12 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 5 | 167 | 3.0E-12 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 5 | 167 | 3.0E-12 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 26 | 167 | 3.0E-12 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 4 | 241 | 3.0E-12 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 96 | 327 | 3.0E-12 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 15 | 284 | 3.0E-12 |
sp|Q28DW0|CIAO1_XENTR | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 | 4 | 241 | 3.0E-12 |
sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 45 | 330 | 3.0E-12 |
sp|Q05583|CIAO1_YEAST | Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 | 15 | 171 | 3.0E-12 |
sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 26 | 326 | 3.0E-12 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 100 | 286 | 3.0E-12 |
sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 26 | 299 | 3.0E-12 |
sp|A6ZYM0|CIAO1_YEAS7 | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 | 15 | 171 | 3.0E-12 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 26 | 286 | 3.0E-12 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 68 | 330 | 3.0E-12 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 33 | 174 | 3.0E-12 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 15 | 293 | 3.0E-12 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 68 | 268 | 3.0E-12 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 5 | 241 | 4.0E-12 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 5 | 241 | 4.0E-12 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 5 | 241 | 4.0E-12 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 5 | 241 | 4.0E-12 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 15 | 167 | 4.0E-12 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 77 | 364 | 4.0E-12 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 92 | 296 | 4.0E-12 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 92 | 296 | 4.0E-12 |
sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 4 | 241 | 4.0E-12 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 15 | 241 | 4.0E-12 |
sp|B3MC74|CIAO1_DROAN | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 | 15 | 288 | 4.0E-12 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 6 | 169 | 4.0E-12 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 20 | 301 | 4.0E-12 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 68 | 268 | 4.0E-12 |
sp|Q5RFQ3|PWP2_PONAB | Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 | 9 | 286 | 4.0E-12 |
sp|Q6BIR9|CIAO1_DEBHA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CIA1 PE=3 SV=1 | 46 | 285 | 4.0E-12 |
sp|Q8NA23|WDR31_HUMAN | WD repeat-containing protein 31 OS=Homo sapiens GN=WDR31 PE=2 SV=1 | 35 | 331 | 4.0E-12 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 27 | 284 | 4.0E-12 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 12 | 142 | 5.0E-12 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 26 | 167 | 5.0E-12 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 96 | 327 | 5.0E-12 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 18 | 286 | 5.0E-12 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 18 | 286 | 5.0E-12 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 5 | 287 | 5.0E-12 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 5 | 286 | 5.0E-12 |
sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 93 | 287 | 5.0E-12 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 15 | 317 | 5.0E-12 |
sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 26 | 299 | 5.0E-12 |
sp|B7QKS1|CIAO1_IXOSC | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 | 5 | 286 | 5.0E-12 |
sp|Q54RP0|AGTA_DICDI | UDP-galactose:fucoside alpha-3-galactosyltransferase OS=Dictyostelium discoideum GN=agtA PE=1 SV=1 | 27 | 286 | 5.0E-12 |
sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 15 | 167 | 5.0E-12 |
sp|Q99973|TEP1_HUMAN | Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2 | 4 | 325 | 5.0E-12 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 4 | 167 | 6.0E-12 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 85 | 302 | 6.0E-12 |
sp|B4JW81|CIAO1_DROGR | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 | 15 | 286 | 6.0E-12 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 8 | 317 | 6.0E-12 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 68 | 283 | 6.0E-12 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 131 | 388 | 7.0E-12 |
sp|Q5A7Q3|PRP46_CANAL | Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 | 89 | 323 | 7.0E-12 |
sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 65 | 292 | 7.0E-12 |
sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 9 | 284 | 7.0E-12 |
sp|Q54J37|STRN_DICDI | Striatin homolog OS=Dictyostelium discoideum GN=strn PE=3 SV=1 | 37 | 317 | 7.0E-12 |
sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 1 | 312 | 8.0E-12 |
sp|Q5DFU0|CIAO1_SCHJA | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 | 5 | 286 | 8.0E-12 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 96 | 327 | 9.0E-12 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 94 | 285 | 1.0E-11 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 2 | 241 | 1.0E-11 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 8 | 240 | 1.0E-11 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 94 | 397 | 1.0E-11 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 94 | 397 | 1.0E-11 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 27 | 169 | 1.0E-11 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 94 | 353 | 1.0E-11 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 94 | 353 | 1.0E-11 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 14 | 162 | 1.0E-11 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 15 | 167 | 1.0E-11 |
sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 35 | 170 | 1.0E-11 |
sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 4 | 244 | 1.0E-11 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 89 | 295 | 1.0E-11 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 40 | 268 | 1.0E-11 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 15 | 317 | 1.0E-11 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 15 | 295 | 1.0E-11 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 15 | 295 | 1.0E-11 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 47 | 325 | 1.0E-11 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 50 | 330 | 1.0E-11 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 50 | 330 | 1.0E-11 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 50 | 330 | 1.0E-11 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 50 | 330 | 1.0E-11 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 50 | 330 | 1.0E-11 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 50 | 330 | 1.0E-11 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 50 | 330 | 1.0E-11 |
sp|Q8K4P0|WDR33_MOUSE | pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 | 1 | 348 | 1.0E-11 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 26 | 169 | 1.0E-11 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 13 | 326 | 1.0E-11 |
sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 13 | 183 | 1.0E-11 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 93 | 295 | 2.0E-11 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 5 | 167 | 2.0E-11 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 26 | 163 | 2.0E-11 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 133 | 323 | 2.0E-11 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 26 | 274 | 2.0E-11 |
sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 15 | 286 | 2.0E-11 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 27 | 169 | 2.0E-11 |
sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 8 | 243 | 2.0E-11 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 53 | 292 | 2.0E-11 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 20 | 235 | 2.0E-11 |
sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 8 | 244 | 2.0E-11 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 39 | 268 | 2.0E-11 |
sp|Q75AV4|PFS2_ASHGO | Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 | 94 | 355 | 2.0E-11 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 15 | 161 | 2.0E-11 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 35 | 170 | 2.0E-11 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 69 | 286 | 2.0E-11 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 5 | 169 | 2.0E-11 |
sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 4 | 241 | 2.0E-11 |
sp|Q6CBI8|CIAO1_YARLI | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 | 3 | 286 | 2.0E-11 |
sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 1 | 286 | 2.0E-11 |
sp|Q9C0J8|WDR33_HUMAN | pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 | 1 | 348 | 2.0E-11 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 27 | 352 | 2.0E-11 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 20 | 292 | 2.0E-11 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 50 | 341 | 2.0E-11 |
sp|Q59WJ4|PFS2_CANAL | Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 | 4 | 274 | 2.0E-11 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 5 | 241 | 3.0E-11 |
sp|B4GDM7|CIAO1_DROPE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 | 15 | 287 | 3.0E-11 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 96 | 327 | 3.0E-11 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 14 | 169 | 3.0E-11 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 40 | 268 | 3.0E-11 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 40 | 268 | 3.0E-11 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 27 | 169 | 3.0E-11 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 33 | 170 | 3.0E-11 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 15 | 232 | 3.0E-11 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 2 | 126 | 3.0E-11 |
sp|Q54JS5|WDR24_DICDI | WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 | 19 | 171 | 3.0E-11 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 50 | 167 | 3.0E-11 |
sp|B9WHJ2|CIAO1_CANDC | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 | 1 | 286 | 3.0E-11 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 53 | 292 | 3.0E-11 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 39 | 173 | 3.0E-11 |
sp|A8PWQ8|CIAO1_MALGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 | 53 | 241 | 3.0E-11 |
sp|Q5ZL33|STRAP_CHICK | Serine-threonine kinase receptor-associated protein OS=Gallus gallus GN=STRAP PE=2 SV=2 | 15 | 284 | 3.0E-11 |
sp|Q6CMA2|CIAO1_KLULA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 | 15 | 167 | 3.0E-11 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 68 | 175 | 4.0E-11 |
sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 8 | 244 | 4.0E-11 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 89 | 295 | 4.0E-11 |
sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 33 | 174 | 4.0E-11 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 15 | 152 | 4.0E-11 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 64 | 359 | 4.0E-11 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1 | 168 | 4.0E-11 |
sp|Q9JHB4|WDR31_MOUSE | WD repeat-containing protein 31 OS=Mus musculus GN=Wdr31 PE=2 SV=1 | 39 | 298 | 4.0E-11 |
sp|A3LVM1|CIAO1_PICST | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CIA1 PE=3 SV=2 | 1 | 284 | 4.0E-11 |
sp|B5X9P2|CIO1A_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 | 4 | 241 | 4.0E-11 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 3 | 168 | 4.0E-11 |
sp|Q9C1X1|PWP2_SCHPO | Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1 | 10 | 292 | 4.0E-11 |
sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 8 | 244 | 5.0E-11 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 4 | 173 | 5.0E-11 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 33 | 174 | 5.0E-11 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1 | 168 | 5.0E-11 |
sp|Q5BJQ6|CSTF1_RAT | Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 | 52 | 278 | 5.0E-11 |
sp|Q99LC2|CSTF1_MOUSE | Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 | 52 | 278 | 5.0E-11 |
sp|Q5AG86|CIAO1_CANAL | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 | 1 | 240 | 5.0E-11 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 42 | 310 | 5.0E-11 |
sp|Q09406|A16L2_CAEEL | Autophagic-related protein 16.2 OS=Caenorhabditis elegans GN=atg-16.2 PE=3 SV=2 | 49 | 310 | 5.0E-11 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 44 | 323 | 6.0E-11 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 44 | 323 | 6.0E-11 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 135 | 292 | 6.0E-11 |
sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 8 | 288 | 6.0E-11 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 39 | 268 | 6.0E-11 |
sp|C5MJE8|LIS1_CANTT | Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 | 7 | 243 | 6.0E-11 |
sp|Q8NAA4|A16L2_HUMAN | Autophagy-related protein 16-2 OS=Homo sapiens GN=ATG16L2 PE=1 SV=2 | 48 | 328 | 6.0E-11 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 14 | 169 | 7.0E-11 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 94 | 353 | 7.0E-11 |
sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 8 | 241 | 7.0E-11 |
sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 8 | 326 | 7.0E-11 |
sp|Q05583|CIAO1_YEAST | Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 | 19 | 241 | 7.0E-11 |
sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 5 | 243 | 7.0E-11 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 64 | 326 | 7.0E-11 |
sp|O08653|TEP1_RAT | Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1 | 18 | 400 | 7.0E-11 |
sp|Q8BU03|PWP2_MOUSE | Periodic tryptophan protein 2 homolog OS=Mus musculus GN=Pwp2 PE=1 SV=1 | 9 | 286 | 7.0E-11 |
sp|B5X212|CIO1B_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 | 4 | 285 | 7.0E-11 |
sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 15 | 244 | 7.0E-11 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 4 | 167 | 8.0E-11 |
sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 15 | 288 | 8.0E-11 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 89 | 283 | 8.0E-11 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 89 | 283 | 8.0E-11 |
sp|Q5R8K2|CSTF1_PONAB | Cleavage stimulation factor subunit 1 OS=Pongo abelii GN=CSTF1 PE=2 SV=1 | 13 | 284 | 8.0E-11 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 8 | 296 | 9.0E-11 |
sp|Q7K1Y4|CIAO1_DROME | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 | 8 | 288 | 9.0E-11 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 33 | 174 | 9.0E-11 |
sp|Q5R8K2|CSTF1_PONAB | Cleavage stimulation factor subunit 1 OS=Pongo abelii GN=CSTF1 PE=2 SV=1 | 52 | 281 | 9.0E-11 |
sp|Q75C26|CIAO1_ASHGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 | 15 | 286 | 9.0E-11 |
sp|Q86A97|TSSC1_DICDI | Protein tssc1 homolog OS=Dictyostelium discoideum GN=tssc1 PE=1 SV=1 | 61 | 172 | 9.0E-11 |
sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 53 | 329 | 9.0E-11 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 15 | 173 | 1.0E-10 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 92 | 447 | 1.0E-10 |
sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 15 | 286 | 1.0E-10 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 49 | 323 | 1.0E-10 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 14 | 169 | 1.0E-10 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 56 | 311 | 1.0E-10 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 89 | 321 | 1.0E-10 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 94 | 355 | 1.0E-10 |
sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 15 | 179 | 1.0E-10 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 100 | 286 | 1.0E-10 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 15 | 286 | 1.0E-10 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 15 | 288 | 1.0E-10 |
sp|O75037|KI21B_HUMAN | Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2 | 18 | 285 | 1.0E-10 |
sp|A7TLU2|CIAO1_VANPO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CIA1 PE=3 SV=1 | 44 | 307 | 1.0E-10 |
sp|Q20636|GBB2_CAEEL | Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 | 38 | 167 | 1.0E-10 |
sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 39 | 237 | 1.0E-10 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 6 | 243 | 2.0E-10 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 92 | 286 | 2.0E-10 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 5 | 204 | 2.0E-10 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 26 | 285 | 2.0E-10 |
sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 15 | 286 | 2.0E-10 |
sp|B4JW81|CIAO1_DROGR | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 | 8 | 244 | 2.0E-10 |
sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 15 | 288 | 2.0E-10 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 14 | 169 | 2.0E-10 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 93 | 286 | 2.0E-10 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 15 | 267 | 2.0E-10 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 6 | 168 | 2.0E-10 |
sp|A6ZYM0|CIAO1_YEAS7 | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 | 19 | 241 | 2.0E-10 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 15 | 167 | 2.0E-10 |
sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 53 | 285 | 2.0E-10 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 13 | 240 | 2.0E-10 |
sp|B5X9P2|CIO1A_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 | 5 | 240 | 2.0E-10 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 15 | 317 | 2.0E-10 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 42 | 325 | 2.0E-10 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 8 | 168 | 2.0E-10 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 26 | 276 | 2.0E-10 |
sp|Q05048|CSTF1_HUMAN | Cleavage stimulation factor subunit 1 OS=Homo sapiens GN=CSTF1 PE=1 SV=1 | 13 | 284 | 2.0E-10 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 38 | 167 | 2.0E-10 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 5 | 168 | 2.0E-10 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 5 | 168 | 2.0E-10 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 5 | 168 | 2.0E-10 |
sp|Q5E959|STRAP_BOVIN | Serine-threonine kinase receptor-associated protein OS=Bos taurus GN=STRAP PE=2 SV=1 | 15 | 284 | 2.0E-10 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 38 | 167 | 2.0E-10 |
sp|Q9Y3F4|STRAP_HUMAN | Serine-threonine kinase receptor-associated protein OS=Homo sapiens GN=STRAP PE=1 SV=1 | 15 | 284 | 2.0E-10 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 27 | 240 | 3.0E-10 |
sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 8 | 244 | 3.0E-10 |
sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 8 | 241 | 3.0E-10 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 54 | 323 | 3.0E-10 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 93 | 286 | 3.0E-10 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 12 | 168 | 3.0E-10 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 9 | 168 | 3.0E-10 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 8 | 168 | 3.0E-10 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 4 | 285 | 3.0E-10 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 4 | 285 | 3.0E-10 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 94 | 402 | 4.0E-10 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 93 | 287 | 4.0E-10 |
sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 15 | 288 | 4.0E-10 |
sp|Q9FUY2|LEUNG_ARATH | Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 | 5 | 284 | 4.0E-10 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 36 | 285 | 4.0E-10 |
sp|Q5BJQ6|CSTF1_RAT | Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 | 13 | 284 | 4.0E-10 |
sp|Q99LC2|CSTF1_MOUSE | Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 | 13 | 284 | 4.0E-10 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 39 | 169 | 4.0E-10 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 55 | 150 | 5.0E-10 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 55 | 150 | 5.0E-10 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 68 | 150 | 5.0E-10 |
sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 8 | 242 | 5.0E-10 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 4 | 173 | 5.0E-10 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 4 | 173 | 5.0E-10 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 39 | 169 | 5.0E-10 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 15 | 244 | 5.0E-10 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 33 | 359 | 5.0E-10 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 92 | 302 | 6.0E-10 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 26 | 167 | 6.0E-10 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 39 | 169 | 6.0E-10 |
sp|Q6CMA2|CIAO1_KLULA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 | 67 | 326 | 6.0E-10 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 20 | 127 | 7.0E-10 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 68 | 150 | 7.0E-10 |
sp|Q17GR9|CIAO1_AEDAE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 | 8 | 241 | 7.0E-10 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 4 | 173 | 7.0E-10 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 4 | 173 | 7.0E-10 |
sp|Q05048|CSTF1_HUMAN | Cleavage stimulation factor subunit 1 OS=Homo sapiens GN=CSTF1 PE=1 SV=1 | 52 | 278 | 7.0E-10 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 18 | 323 | 8.0E-10 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 9 | 167 | 8.0E-10 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 94 | 299 | 9.0E-10 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 94 | 299 | 9.0E-10 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 133 | 368 | 9.0E-10 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 90 | 344 | 1.0E-09 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 94 | 299 | 1.0E-09 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 15 | 241 | 1.0E-09 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 93 | 287 | 1.0E-09 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 92 | 353 | 1.0E-09 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 94 | 355 | 1.0E-09 |
sp|Q2TZG4|PFS2_ASPOR | Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 | 2 | 234 | 1.0E-09 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 35 | 170 | 1.0E-09 |
sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 65 | 327 | 1.0E-09 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 36 | 295 | 1.0E-09 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 136 | 316 | 2.0E-09 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 15 | 173 | 2.0E-09 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 71 | 150 | 2.0E-09 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 26 | 150 | 2.0E-09 |
sp|B3RNR8|CIAO1_TRIAD | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 | 96 | 329 | 2.0E-09 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 89 | 295 | 2.0E-09 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 54 | 323 | 2.0E-09 |
sp|Q2TZG4|PFS2_ASPOR | Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 | 9 | 164 | 2.0E-09 |
sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 101 | 310 | 2.0E-09 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 96 | 295 | 2.0E-09 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 96 | 295 | 2.0E-09 |
sp|Q59WJ4|PFS2_CANAL | Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 | 5 | 267 | 2.0E-09 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 12 | 240 | 2.0E-09 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 20 | 127 | 3.0E-09 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 136 | 317 | 3.0E-09 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 26 | 172 | 3.0E-09 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 52 | 150 | 3.0E-09 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 52 | 150 | 3.0E-09 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 92 | 353 | 3.0E-09 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 35 | 170 | 3.0E-09 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 92 | 287 | 3.0E-09 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 56 | 284 | 3.0E-09 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 94 | 397 | 3.0E-09 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 100 | 317 | 3.0E-09 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 65 | 181 | 3.0E-09 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 4 | 285 | 3.0E-09 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 6 | 169 | 4.0E-09 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 7 | 180 | 4.0E-09 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 15 | 150 | 4.0E-09 |
sp|B4GDM7|CIAO1_DROPE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 | 8 | 244 | 4.0E-09 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 56 | 295 | 4.0E-09 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 56 | 295 | 4.0E-09 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 93 | 353 | 4.0E-09 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 27 | 167 | 4.0E-09 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 3 | 317 | 4.0E-09 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 3 | 317 | 4.0E-09 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 206 | 300 | 5.0E-09 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 15 | 173 | 5.0E-09 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 8 | 173 | 5.0E-09 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 93 | 295 | 5.0E-09 |
sp|Q292E8|CIAO1_DROPS | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 | 8 | 244 | 6.0E-09 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 16 | 127 | 7.0E-09 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 56 | 284 | 7.0E-09 |
sp|Q59WJ4|PFS2_CANAL | Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 | 101 | 309 | 7.0E-09 |
sp|A8PWQ8|CIAO1_MALGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 | 15 | 167 | 7.0E-09 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 7 | 136 | 8.0E-09 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 7 | 136 | 8.0E-09 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 33 | 170 | 8.0E-09 |
sp|Q5DFU0|CIAO1_SCHJA | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 | 5 | 181 | 9.0E-09 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 8 | 170 | 1.0E-08 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 80 | 299 | 1.0E-08 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 93 | 295 | 1.0E-08 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 15 | 150 | 1.0E-08 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 136 | 364 | 1.0E-08 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 136 | 364 | 1.0E-08 |
sp|Q4I7X1|PFS2_GIBZE | Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 | 26 | 276 | 1.0E-08 |
sp|Q9W5Z5|WSB1_TAKRU | WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 | 4 | 168 | 1.0E-08 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 18 | 284 | 1.0E-08 |
sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 101 | 331 | 1.0E-08 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 8 | 240 | 1.0E-08 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 5 | 170 | 1.0E-08 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 8 | 170 | 2.0E-08 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 94 | 285 | 2.0E-08 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 65 | 181 | 2.0E-08 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 113 | 325 | 2.0E-08 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 15 | 167 | 2.0E-08 |
sp|Q9UT57|CFD1_SCHPO | Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 | 85 | 368 | 2.0E-08 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 13 | 125 | 2.0E-08 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 88 | 330 | 2.0E-08 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 15 | 167 | 2.0E-08 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 204 | 317 | 3.0E-08 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 91 | 300 | 3.0E-08 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 68 | 150 | 3.0E-08 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 136 | 295 | 4.0E-08 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 205 | 317 | 4.0E-08 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 7 | 132 | 4.0E-08 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 208 | 395 | 4.0E-08 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 4 | 126 | 4.0E-08 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 136 | 364 | 4.0E-08 |
sp|B0XAF3|CIAO1_CULQU | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 | 8 | 244 | 4.0E-08 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 79 | 364 | 4.0E-08 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 93 | 325 | 4.0E-08 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 53 | 334 | 4.0E-08 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 88 | 330 | 4.0E-08 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 5 | 134 | 4.0E-08 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 68 | 167 | 5.0E-08 |
sp|Q9NRL3|STRN4_HUMAN | Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 | 68 | 325 | 5.0E-08 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 15 | 170 | 5.0E-08 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 2 | 167 | 5.0E-08 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 206 | 300 | 6.0E-08 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 15 | 125 | 6.0E-08 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 93 | 353 | 6.0E-08 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 53 | 344 | 7.0E-08 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 80 | 286 | 7.0E-08 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 204 | 317 | 8.0E-08 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 5 | 125 | 8.0E-08 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 37 | 150 | 8.0E-08 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 33 | 170 | 8.0E-08 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 4 | 187 | 9.0E-08 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 134 | 295 | 9.0E-08 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 8 | 241 | 9.0E-08 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 8 | 241 | 9.0E-08 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 8 | 241 | 9.0E-08 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 8 | 241 | 9.0E-08 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 8 | 241 | 9.0E-08 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 21 | 172 | 9.0E-08 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 7 | 83 | 1.0E-07 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 5 | 167 | 1.0E-07 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 204 | 317 | 1.0E-07 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 7 | 132 | 1.0E-07 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 91 | 302 | 1.0E-07 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 35 | 150 | 1.0E-07 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 68 | 150 | 1.0E-07 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 89 | 285 | 1.0E-07 |
sp|P58404|STRN4_MOUSE | Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 | 68 | 325 | 1.0E-07 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 5 | 125 | 1.0E-07 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 204 | 395 | 1.0E-07 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 5 | 169 | 1.0E-07 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 89 | 260 | 1.0E-07 |
sp|Q28DW0|CIAO1_XENTR | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 | 13 | 241 | 1.0E-07 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 53 | 244 | 1.0E-07 |
sp|Q6CMA2|CIAO1_KLULA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 | 26 | 167 | 1.0E-07 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 18 | 169 | 1.0E-07 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 18 | 169 | 1.0E-07 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 20 | 127 | 2.0E-07 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 37 | 150 | 2.0E-07 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 37 | 150 | 2.0E-07 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 89 | 310 | 2.0E-07 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 8 | 241 | 2.0E-07 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 35 | 170 | 2.0E-07 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 4 | 167 | 2.0E-07 |
sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 5 | 186 | 2.0E-07 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 15 | 169 | 2.0E-07 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 15 | 167 | 2.0E-07 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 33 | 170 | 2.0E-07 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 33 | 170 | 2.0E-07 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 33 | 170 | 2.0E-07 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 33 | 170 | 2.0E-07 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 33 | 170 | 2.0E-07 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 33 | 170 | 2.0E-07 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 33 | 170 | 2.0E-07 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 15 | 167 | 2.0E-07 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 206 | 300 | 3.0E-07 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 94 | 286 | 3.0E-07 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 5 | 169 | 3.0E-07 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 5 | 126 | 3.0E-07 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 208 | 367 | 3.0E-07 |
sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 8 | 241 | 3.0E-07 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 8 | 241 | 3.0E-07 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 12 | 341 | 3.0E-07 |
sp|Q8W117|SMU1_ARATH | Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 | 8 | 241 | 3.0E-07 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 221 | 344 | 3.0E-07 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 20 | 131 | 4.0E-07 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 20 | 127 | 4.0E-07 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 205 | 317 | 4.0E-07 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 205 | 317 | 4.0E-07 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 205 | 317 | 4.0E-07 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 205 | 317 | 4.0E-07 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 180 | 299 | 4.0E-07 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 131 | 363 | 4.0E-07 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 49 | 167 | 4.0E-07 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 49 | 167 | 4.0E-07 |
sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 5 | 243 | 4.0E-07 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 49 | 167 | 5.0E-07 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 49 | 167 | 5.0E-07 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 55 | 399 | 5.0E-07 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 1 | 168 | 5.0E-07 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 91 | 286 | 6.0E-07 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 93 | 287 | 6.0E-07 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 5 | 125 | 6.0E-07 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 53 | 170 | 6.0E-07 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 135 | 397 | 7.0E-07 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 5 | 169 | 7.0E-07 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 5 | 125 | 7.0E-07 |
sp|Q5I0B9|ATG16_XENTR | Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 | 8 | 169 | 7.0E-07 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 68 | 150 | 9.0E-07 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 5 | 169 | 1.0E-06 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 89 | 260 | 1.0E-06 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 89 | 260 | 1.0E-06 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 4 | 125 | 1.0E-06 |
sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 4 | 125 | 1.0E-06 |
sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 91 | 302 | 1.0E-06 |
sp|A8PWQ8|CIAO1_MALGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 | 135 | 323 | 1.0E-06 |
sp|Q75C26|CIAO1_ASHGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 | 58 | 284 | 1.0E-06 |
sp|Q20636|GBB2_CAEEL | Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 | 65 | 240 | 1.0E-06 |
sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 26 | 164 | 1.0E-06 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 20 | 127 | 2.0E-06 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 20 | 159 | 2.0E-06 |
sp|C4R6H3|LIS1_PICPG | Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 | 139 | 295 | 2.0E-06 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 5 | 169 | 2.0E-06 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 5 | 169 | 2.0E-06 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 5 | 169 | 2.0E-06 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 5 | 169 | 2.0E-06 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 8 | 154 | 2.0E-06 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 8 | 387 | 2.0E-06 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 221 | 344 | 2.0E-06 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 221 | 344 | 2.0E-06 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 36 | 168 | 2.0E-06 |
sp|Q676U5|A16L1_HUMAN | Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 | 5 | 169 | 2.0E-06 |
sp|Q8C0J2|A16L1_MOUSE | Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 | 8 | 169 | 2.0E-06 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 80 | 316 | 2.0E-06 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 35 | 168 | 2.0E-06 |
sp|Q9C1X1|PWP2_SCHPO | Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1 | 5 | 169 | 2.0E-06 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 101 | 330 | 2.0E-06 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 189 | 285 | 3.0E-06 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 20 | 127 | 3.0E-06 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 5 | 170 | 3.0E-06 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 2 | 181 | 3.0E-06 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 2 | 181 | 3.0E-06 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 53 | 169 | 3.0E-06 |
sp|Q54J37|STRN_DICDI | Striatin homolog OS=Dictyostelium discoideum GN=strn PE=3 SV=1 | 17 | 166 | 3.0E-06 |
sp|A3LVM1|CIAO1_PICST | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CIA1 PE=3 SV=2 | 4 | 241 | 3.0E-06 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 189 | 285 | 4.0E-06 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 203 | 360 | 4.0E-06 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 203 | 360 | 4.0E-06 |
sp|Q05583|CIAO1_YEAST | Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 | 4 | 125 | 4.0E-06 |
sp|A6ZYM0|CIAO1_YEAS7 | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIA1 PE=3 SV=1 | 4 | 125 | 4.0E-06 |
sp|A7TLU2|CIAO1_VANPO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CIA1 PE=3 SV=1 | 10 | 284 | 4.0E-06 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 208 | 394 | 5.0E-06 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 148 | 330 | 5.0E-06 |
sp|C4R6H3|LIS1_PICPG | Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 | 13 | 168 | 5.0E-06 |
sp|C4R6H3|LIS1_PICPG | Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 | 49 | 168 | 5.0E-06 |
sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 144 | 300 | 5.0E-06 |
sp|Q5BJQ6|CSTF1_RAT | Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 | 53 | 287 | 5.0E-06 |
sp|Q99LC2|CSTF1_MOUSE | Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 | 53 | 287 | 5.0E-06 |
sp|Q5RAC9|A16L1_PONAB | Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 | 2 | 169 | 6.0E-06 |
sp|Q75C26|CIAO1_ASHGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 | 4 | 244 | 6.0E-06 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 206 | 364 | 7.0E-06 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 206 | 364 | 7.0E-06 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 2 | 175 | 7.0E-06 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 12 | 176 | 8.0E-06 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 208 | 357 | 9.0E-06 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 19 | 285 | 9.0E-06 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 12 | 341 | 9.0E-06 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 26 | 126 | 9.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016192 | vesicle-mediated transport | Yes |
GO:0030117 | membrane coat | Yes |
GO:0006886 | intracellular protein transport | Yes |
GO:0030126 | COPI vesicle coat | Yes |
GO:0005198 | structural molecule activity | Yes |
GO:0005515 | protein binding | Yes |
GO:0046907 | intracellular transport | No |
GO:0005575 | cellular_component | No |
GO:0033036 | macromolecule localization | No |
GO:0003674 | molecular_function | No |
GO:0051641 | cellular localization | No |
GO:0032991 | protein-containing complex | No |
GO:0015031 | protein transport | No |
GO:0071705 | nitrogen compound transport | No |
GO:0005488 | binding | No |
GO:0098796 | membrane protein complex | No |
GO:0030120 | vesicle coat | No |
GO:0009987 | cellular process | No |
GO:0008104 | protein localization | No |
GO:0006810 | transport | No |
GO:0051649 | establishment of localization in cell | No |
GO:0045184 | establishment of protein localization | No |
GO:0071702 | organic substance transport | No |
GO:0051234 | establishment of localization | No |
GO:0070727 | cellular macromolecule localization | No |
GO:0008150 | biological_process | No |
GO:0051179 | localization | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 29 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|699950 MSVMLTKFESKSNRVKGLAFHPTQPLLAASLHNGSVQLWNYRMGVLVDRFEEHEGPVRGVAIHPSRALLVTGGDD YKIKVWDIRPQNRRCLFTLLGHLDYVRTVQFHHEMPWILSASDDQTIRIWNSTSRQCIAILTGHAHYVMSAQFHP KEDLVVSASMDQTVRVWDISGLRKGSPHQGGPGGMAGTSGPGSNHFETFDNFSTVKYVLEGHDRGVNFAMFHPTL PLIISAGDDRVIKIWRMSETKAWEVDSCRGHFNNVSSALFHPKHELIVSCGEDKTIRVWDLAKRTAIQTFRRDHD RFWYLAAHPNLNLFAAGHDSGLIVFKLERERPAFTVHQDTLYYVRDKYIRSYDFSSGSDIGLLSVRKFGSPYLPP RTISFNPAERSVILTISSDNGLYELSALPQSAQGEVKDSSADGKKGSGNSAIFVARNRFAALNKTTQLIEVRDLS NSTVKTIKPPVQTNEIFYGGTACLILSSTSSVVLYDIQQQKTIAELNSPPVKYVVWSNDGSLVALMSKHTITIAN KTFSQHTLIHETIRIKSGAWDDSGVFLYSTLNHVKYCLAQGDHGVICTLDNPVYLTRVKGKTVHCLDRSARPRTI TFDPTEYRFKLALLRNNYEEMLYIIRTSNLLGQSIIAYLQKKGFPEIALHFVQDTNTRFELAIECGNLDVAMETA REIDRPDCWERLAQQALKQGNHKVVEKAYQQTKNFDKLSFLYLATGSTEKLSKMQKIADARGDPMSRFHNALYAG DVAGRIAVLREVGLHPLAYLTAKGNGLDELAAEILEAAGLTEADIDDVPIFGASTLRPPPVVTSTENYNWPILSQ GENYFDRALANGSLEGGVEPAYVNGDANAAASSALDAWARDEEIQDEIDPEEGGWELDADADEFKEDEAAEEVVE EEQELGAGAAPGVDETELWVRNSPLAADHVAAGSFESAMQLLNRQFGISNFAPLKPLFLSIYRSSHVYLSPVASL PPLKLHVRRNIGESAPSKVLPVAARSIQSVRSELAEGYRSVSSNKLTEAQATFRSVLQALLLVVIASDDEAKQWR DTVTSAREYLLGVSIELERRRVVEQEPDNLRRNLELAAYFTHCQLQPPQLQIALRSAIGAFAKANNQAHAARFAK RLLELNPDPKIAAQARQRIAAGDRNPRNTVEISYDEFTSFDICAATYTPIYKGSPSVHCPYTDAAYLPECQGKLD PLMELTEIGAPAAGLPAAW* |
Coding | >Agabi119p4|699950 ATGTCGGTAATGCTCACAAAGTTCGAATCAAAAAGCAATCGTGTAAAAGGGCTTGCATTTCACCCTACGCAACCT CTCCTTGCGGCATCACTGCATAATGGAAGTGTACAGTTGTGGAACTATCGTATGGGAGTACTGGTCGATCGATTT GAGGAACATGAGGGTCCCGTAAGAGGAGTCGCCATACATCCAAGTAGAGCCTTACTAGTGACTGGTGGAGATGAT TATAAAATCAAAGTCTGGGACATACGACCGCAAAATCGGCGTTGTTTGTTCACCCTACTCGGTCACTTGGATTAT GTTCGAACCGTACAGTTCCACCACGAGATGCCCTGGATCCTTTCTGCATCTGACGACCAAACGATTCGTATATGG AACAGCACATCTCGCCAATGCATCGCTATCCTCACGGGCCATGCACACTACGTCATGTCGGCCCAATTTCATCCC AAAGAAGATCTTGTAGTTTCTGCTTCAATGGATCAAACAGTCCGCGTTTGGGATATCTCAGGGCTTCGCAAAGGT TCACCTCACCAAGGTGGTCCGGGGGGCATGGCTGGCACGAGCGGTCCTGGGTCTAATCACTTTGAAACGTTCGAC AATTTCTCCACCGTCAAGTATGTTTTGGAGGGTCACGATCGCGGAGTCAATTTCGCCATGTTCCATCCCACCCTT CCTCTCATCATTTCCGCTGGTGATGACCGCGTAATCAAAATTTGGAGGATGAGTGAAACCAAGGCATGGGAGGTT GATTCATGCCGGGGTCATTTCAACAACGTTTCGAGTGCATTGTTCCACCCCAAGCACGAGTTGATAGTGTCTTGT GGTGAAGACAAGACCATTCGAGTTTGGGACCTTGCAAAGAGAACTGCCATCCAAACGTTCAGGCGTGATCATGAC AGGTTCTGGTATCTCGCTGCGCATCCCAACCTCAACCTCTTCGCAGCTGGACACGACAGCGGTCTAATCGTCTTC AAACTCGAGCGTGAGCGTCCGGCGTTTACGGTGCACCAAGATACACTGTATTACGTACGAGACAAGTATATTCGT TCTTACGACTTTTCTTCTGGTTCGGACATTGGTCTCCTCAGCGTCCGCAAGTTCGGTAGTCCTTACCTTCCACCT CGAACAATCAGCTTCAACCCGGCTGAGCGGTCTGTGATACTGACCATCAGTTCAGACAATGGGCTTTACGAGCTT TCAGCTCTGCCCCAGTCTGCGCAAGGGGAGGTCAAGGACTCGAGTGCCGATGGTAAAAAAGGAAGCGGGAATAGC GCCATCTTTGTTGCGAGGAACAGGTTTGCAGCGCTCAATAAGACTACTCAACTCATCGAAGTTCGCGATCTATCC AATTCGACGGTGAAAACCATCAAGCCTCCCGTTCAGACCAACGAGATTTTCTATGGAGGCACTGCTTGCCTTATC TTGAGTTCCACATCATCTGTGGTTCTTTACGATATTCAGCAACAGAAGACAATCGCGGAGCTTAACAGTCCTCCC GTTAAGTACGTGGTTTGGAGCAACGATGGGTCGCTGGTTGCTCTCATGAGCAAACATACTATCACGATTGCCAAT AAGACCTTCTCGCAGCATACTTTGATTCATGAAACCATTCGTATCAAATCTGGTGCCTGGGACGATTCCGGGGTA TTCTTGTATTCTACACTCAATCACGTCAAATATTGTCTGGCCCAAGGTGATCATGGTGTTATCTGTACACTGGAT AACCCTGTTTACCTTACCCGCGTGAAGGGTAAAACTGTTCATTGCCTTGACCGATCGGCACGTCCTCGCACAATT ACCTTTGATCCGACGGAATACCGCTTCAAGCTGGCTTTGTTGAGGAATAATTATGAAGAGATGTTGTACATTATC CGGACGTCGAACCTCCTTGGTCAGAGCATCATAGCGTATTTGCAGAAAAAGGGCTTCCCCGAGATCGCTCTTCAC TTTGTTCAAGATACCAACACCCGCTTTGAACTCGCGATTGAGTGCGGTAACCTTGACGTTGCAATGGAGACTGCT AGAGAGATTGATCGACCTGATTGCTGGGAGAGGCTGGCTCAGCAAGCTTTGAAGCAAGGCAACCACAAGGTCGTC GAGAAGGCGTACCAGCAAACCAAAAACTTTGACAAATTGTCTTTCCTCTACCTCGCCACTGGTAGCACCGAAAAA TTGTCTAAAATGCAAAAAATCGCTGATGCTCGTGGGGATCCCATGTCTCGTTTCCACAACGCGTTGTATGCGGGC GACGTTGCCGGTAGAATAGCTGTTCTGAGGGAGGTTGGTCTCCACCCCTTGGCATATCTCACAGCAAAGGGCAAC GGCTTGGACGAGCTTGCAGCTGAGATCCTCGAAGCTGCTGGTCTTACGGAAGCTGACATCGACGATGTCCCGATA TTTGGAGCATCGACACTCCGACCTCCGCCAGTTGTTACCTCGACGGAAAACTACAATTGGCCTATACTTTCACAA GGAGAAAACTACTTTGATCGTGCGTTAGCGAATGGAAGTTTGGAAGGTGGTGTGGAGCCTGCGTATGTTAATGGG GATGCTAATGCAGCAGCATCCTCTGCATTGGATGCTTGGGCTAGGGATGAAGAAATTCAGGATGAGATTGATCCT GAGGAGGGCGGATGGGAATTGGATGCGGACGCAGATGAATTCAAGGAGGACGAAGCTGCTGAAGAGGTTGTAGAG GAGGAACAAGAGTTAGGTGCGGGTGCGGCACCTGGTGTGGATGAGACAGAGTTGTGGGTACGGAACTCACCATTG GCGGCCGACCATGTGGCTGCGGGATCATTCGAGTCTGCTATGCAGCTGCTTAACCGACAGTTTGGTATAAGTAAC TTTGCACCACTTAAACCTCTCTTCTTGTCGATATACCGCTCTTCACATGTTTATCTTTCGCCCGTTGCGTCTCTC CCTCCTTTGAAATTGCACGTGAGGCGTAATATCGGAGAATCTGCACCTAGCAAAGTGCTACCCGTCGCTGCGCGC TCAATACAGTCTGTGCGGTCAGAATTGGCGGAGGGCTATAGATCAGTATCGAGCAATAAGCTTACGGAAGCACAA GCGACGTTCCGTTCAGTGCTGCAGGCACTGCTATTAGTTGTCATTGCATCAGATGATGAAGCTAAGCAGTGGAGA GATACTGTGACTTCTGCTCGGGAATACTTGCTCGGCGTCTCCATTGAACTTGAGCGGAGGCGCGTTGTGGAACAG GAACCTGATAACCTGCGGAGAAACCTTGAACTTGCAGCATATTTCACGCACTGTCAATTGCAACCTCCACAGTTA CAAATTGCACTTCGTAGTGCCATTGGTGCATTTGCTAAGGCGAATAACCAAGCACATGCTGCGCGCTTCGCGAAA CGGTTATTGGAGCTTAATCCTGATCCAAAGATTGCTGCACAGGCAAGACAACGAATTGCTGCCGGAGATCGTAAT CCAAGAAATACGGTAGAGATTTCGTATGACGAATTTACGTCATTTGATATTTGTGCTGCGACGTATACGCCGATT TATAAAGGTTCACCGTCGGTGCATTGTCCGTATACGGATGCAGCGTACTTGCCAGAGTGTCAAGGAAAGCTTGAC CCGTTGATGGAGTTGACTGAGATTGGCGCTCCGGCTGCTGGACTGCCTGCTGCGTGGTGA |
Transcript | >Agabi119p4|699950 ATGTCGGTAATGCTCACAAAGTTCGAATCAAAAAGCAATCGTGTAAAAGGGCTTGCATTTCACCCTACGCAACCT CTCCTTGCGGCATCACTGCATAATGGAAGTGTACAGTTGTGGAACTATCGTATGGGAGTACTGGTCGATCGATTT GAGGAACATGAGGGTCCCGTAAGAGGAGTCGCCATACATCCAAGTAGAGCCTTACTAGTGACTGGTGGAGATGAT TATAAAATCAAAGTCTGGGACATACGACCGCAAAATCGGCGTTGTTTGTTCACCCTACTCGGTCACTTGGATTAT GTTCGAACCGTACAGTTCCACCACGAGATGCCCTGGATCCTTTCTGCATCTGACGACCAAACGATTCGTATATGG AACAGCACATCTCGCCAATGCATCGCTATCCTCACGGGCCATGCACACTACGTCATGTCGGCCCAATTTCATCCC AAAGAAGATCTTGTAGTTTCTGCTTCAATGGATCAAACAGTCCGCGTTTGGGATATCTCAGGGCTTCGCAAAGGT TCACCTCACCAAGGTGGTCCGGGGGGCATGGCTGGCACGAGCGGTCCTGGGTCTAATCACTTTGAAACGTTCGAC AATTTCTCCACCGTCAAGTATGTTTTGGAGGGTCACGATCGCGGAGTCAATTTCGCCATGTTCCATCCCACCCTT CCTCTCATCATTTCCGCTGGTGATGACCGCGTAATCAAAATTTGGAGGATGAGTGAAACCAAGGCATGGGAGGTT GATTCATGCCGGGGTCATTTCAACAACGTTTCGAGTGCATTGTTCCACCCCAAGCACGAGTTGATAGTGTCTTGT GGTGAAGACAAGACCATTCGAGTTTGGGACCTTGCAAAGAGAACTGCCATCCAAACGTTCAGGCGTGATCATGAC AGGTTCTGGTATCTCGCTGCGCATCCCAACCTCAACCTCTTCGCAGCTGGACACGACAGCGGTCTAATCGTCTTC AAACTCGAGCGTGAGCGTCCGGCGTTTACGGTGCACCAAGATACACTGTATTACGTACGAGACAAGTATATTCGT TCTTACGACTTTTCTTCTGGTTCGGACATTGGTCTCCTCAGCGTCCGCAAGTTCGGTAGTCCTTACCTTCCACCT CGAACAATCAGCTTCAACCCGGCTGAGCGGTCTGTGATACTGACCATCAGTTCAGACAATGGGCTTTACGAGCTT TCAGCTCTGCCCCAGTCTGCGCAAGGGGAGGTCAAGGACTCGAGTGCCGATGGTAAAAAAGGAAGCGGGAATAGC GCCATCTTTGTTGCGAGGAACAGGTTTGCAGCGCTCAATAAGACTACTCAACTCATCGAAGTTCGCGATCTATCC AATTCGACGGTGAAAACCATCAAGCCTCCCGTTCAGACCAACGAGATTTTCTATGGAGGCACTGCTTGCCTTATC TTGAGTTCCACATCATCTGTGGTTCTTTACGATATTCAGCAACAGAAGACAATCGCGGAGCTTAACAGTCCTCCC GTTAAGTACGTGGTTTGGAGCAACGATGGGTCGCTGGTTGCTCTCATGAGCAAACATACTATCACGATTGCCAAT AAGACCTTCTCGCAGCATACTTTGATTCATGAAACCATTCGTATCAAATCTGGTGCCTGGGACGATTCCGGGGTA TTCTTGTATTCTACACTCAATCACGTCAAATATTGTCTGGCCCAAGGTGATCATGGTGTTATCTGTACACTGGAT AACCCTGTTTACCTTACCCGCGTGAAGGGTAAAACTGTTCATTGCCTTGACCGATCGGCACGTCCTCGCACAATT ACCTTTGATCCGACGGAATACCGCTTCAAGCTGGCTTTGTTGAGGAATAATTATGAAGAGATGTTGTACATTATC CGGACGTCGAACCTCCTTGGTCAGAGCATCATAGCGTATTTGCAGAAAAAGGGCTTCCCCGAGATCGCTCTTCAC TTTGTTCAAGATACCAACACCCGCTTTGAACTCGCGATTGAGTGCGGTAACCTTGACGTTGCAATGGAGACTGCT AGAGAGATTGATCGACCTGATTGCTGGGAGAGGCTGGCTCAGCAAGCTTTGAAGCAAGGCAACCACAAGGTCGTC GAGAAGGCGTACCAGCAAACCAAAAACTTTGACAAATTGTCTTTCCTCTACCTCGCCACTGGTAGCACCGAAAAA TTGTCTAAAATGCAAAAAATCGCTGATGCTCGTGGGGATCCCATGTCTCGTTTCCACAACGCGTTGTATGCGGGC GACGTTGCCGGTAGAATAGCTGTTCTGAGGGAGGTTGGTCTCCACCCCTTGGCATATCTCACAGCAAAGGGCAAC GGCTTGGACGAGCTTGCAGCTGAGATCCTCGAAGCTGCTGGTCTTACGGAAGCTGACATCGACGATGTCCCGATA TTTGGAGCATCGACACTCCGACCTCCGCCAGTTGTTACCTCGACGGAAAACTACAATTGGCCTATACTTTCACAA GGAGAAAACTACTTTGATCGTGCGTTAGCGAATGGAAGTTTGGAAGGTGGTGTGGAGCCTGCGTATGTTAATGGG GATGCTAATGCAGCAGCATCCTCTGCATTGGATGCTTGGGCTAGGGATGAAGAAATTCAGGATGAGATTGATCCT GAGGAGGGCGGATGGGAATTGGATGCGGACGCAGATGAATTCAAGGAGGACGAAGCTGCTGAAGAGGTTGTAGAG GAGGAACAAGAGTTAGGTGCGGGTGCGGCACCTGGTGTGGATGAGACAGAGTTGTGGGTACGGAACTCACCATTG GCGGCCGACCATGTGGCTGCGGGATCATTCGAGTCTGCTATGCAGCTGCTTAACCGACAGTTTGGTATAAGTAAC TTTGCACCACTTAAACCTCTCTTCTTGTCGATATACCGCTCTTCACATGTTTATCTTTCGCCCGTTGCGTCTCTC CCTCCTTTGAAATTGCACGTGAGGCGTAATATCGGAGAATCTGCACCTAGCAAAGTGCTACCCGTCGCTGCGCGC TCAATACAGTCTGTGCGGTCAGAATTGGCGGAGGGCTATAGATCAGTATCGAGCAATAAGCTTACGGAAGCACAA GCGACGTTCCGTTCAGTGCTGCAGGCACTGCTATTAGTTGTCATTGCATCAGATGATGAAGCTAAGCAGTGGAGA GATACTGTGACTTCTGCTCGGGAATACTTGCTCGGCGTCTCCATTGAACTTGAGCGGAGGCGCGTTGTGGAACAG GAACCTGATAACCTGCGGAGAAACCTTGAACTTGCAGCATATTTCACGCACTGTCAATTGCAACCTCCACAGTTA CAAATTGCACTTCGTAGTGCCATTGGTGCATTTGCTAAGGCGAATAACCAAGCACATGCTGCGCGCTTCGCGAAA CGGTTATTGGAGCTTAATCCTGATCCAAAGATTGCTGCACAGGCAAGACAACGAATTGCTGCCGGAGATCGTAAT CCAAGAAATACGGTAGAGATTTCGTATGACGAATTTACGTCATTTGATATTTGTGCTGCGACGTATACGCCGATT TATAAAGGTTCACCGTCGGTGCATTGTCCGTATACGGATGCAGCGTACTTGCCAGAGTGTCAAGGAAAGCTTGAC CCGTTGATGGAGTTGACTGAGATTGGCGCTCCGGCTGCTGGACTGCCTGCTGCGTGGTGA |
Gene | >Agabi119p4|699950 ATGTCGGTAATGCTCACAAAGTTCGAATCAAAAAGCAATCGTGTAAAAGGTGACATCCAAAATCCGCTAAGAATC CAAGGATTATCTCGCTCATCCGTGACGATAGGGCTTGCATTTCACCCTACGCAACCTCTCCTTGCGGCATCACTG CATAATGGAAGTGTACAGTTGTGGAACTATCGTATGGGAGTACTGGTCGATCGATTTGAGGAACATGAGGGTGAG CATTCGCAACTTGGATGTGCGGGCCAATTAAAGATTTTACGTGTGTAGGTCCCGTAAGAGGAGTCGCCATACATC CAAGTAGAGCCTTACTAGTGACTGGTGGAGATGATTATAAAATCAAAGTCTGGGGTGCGTAGTTGTCTATGGATC AAACTTGTGATAAAAGATCCTAATTTGCGATAAAATGTAGACATACGACCGCAAAATCGGCGTTGTTTGTTCACC CTACTCGGTCACTTGGATTATGTTCGAACCGTACAGTTCCACCACGAGATGCCCTGGATCGTACGTATACAATGT CTGCTGAATCAATGTTTTGTCTGAAGACGCCCTGGTAGCTTTCTGCATCTGACGACCAAACGATTCGTATATGGA ACAGCACATCTCGCCAATGCATCGCTATCCTCACGGGCCATGCACACTACGTCATGTCGGCCCAATTTCATCCCA AAGAAGATCTTGTAGTTTCTGCTTCAATGGATCAAACAGTCCGCGTTTGGGATATCTCAGGGCTTCGCAAAGGTT CACCTCACCAAGGTGGTCCGGGGGGCATGGCTGGCACGAGCGGTCCTGGGTCTAATCACTTTGAAACGTTCGACA ATTTCTCCACCGTCAAGTATGTTTTGGAGGGTCACGATCGCGGAGTCAATTTCGCCATGTTCCATCCCACCCTTC CTCTCATCATTTCCGCTGGTGATGACCGCGTAATCAAAATTTGGAGGATGAGTGAAACCAAGGCATGGGAGGTTG ATTCATGCCGGGGTCATTTCAACAACGTTTCGAGTGCATTGTTCCACCCCAAGCACGAGTTGATAGTGTCTTGTG GTGAAGACAAGACCATTCGAGTTTGGGACCTTGCAAAGAGAACTGCCATCCAAACGTTCAGGCGTGATCATGACA GGTTCTGGTATCTCGCTGCGCATCCCAACCTCAACCTCTTCGCAGCTGGACACGACAGCGGTCTAATCGTCTTCA AACTCGAGCGTGAGCGTCCGGCGTTTACGGTGCACCAAGATACACTGTATTACGTACGAGACAAGTATATTCGTT CTTACGACTTTTCTTCTGGTTCGGACATTGGTCTCCTCAGCGTCCGCAAGTTCGGTAGTCCTTACCTTCCACCTC GAACAATCAGCTTCAACCCGGCTGAGCGGTCTGTGATACTGACCATCAGTTCAGACAATGGGCTTTACGAGCTTT CAGCTCTGCCCCAGTCTGCGCAAGGGGAGGTCAAGGACTCGAGTGCCGATGGTAAAAAAGGAAGCGGGAATAGCG CCATCTTTGTTGCGAGGAACAGGTTTGCAGCGCTCAATAAGACTACTCAAGTAAGTAGCATTTACTATAGTTGCT GGTTTTCGGGGCTAATAACAATACAAAGCTCATCGAAGTTCGCGATCTATCCAATTCGACGGTGAAAACCATCAA GCCTCCCGTTCAGACCAACGAGATTTTCTATGGAGGCACTGCTTGCCTTATCTTGAGTTCCACATCATCTGTGGT TCTTTACGATATTCAGCAACAGAAGACAATCGCGGAGCTTAACAGTCCTCCCGTTAAGTACGTGGTTTGGAGCAA CGATGGGTCGCTGGTTGCTCTCATGAGCAAACATAGTGAGTTTAATGCTTGCCCGTCCGGTGCATATAGCTCAGA AGACACATAGCTATCACGATTGCCAATAAGACCTTCTCGCAGCATACTTTGATTCATGAAACCATTCGTATCAAA TCTGGTGCCTGGGACGATTCCGGGGTATTCTTGTATTCTACACTCAATCACGTCAAATATTGTCTGGCCCAAGGG TACGTCGTTTTCGCTATCGAATTTTCTGCCTTTGTTGATGCAGTTTTTTTGTATTAGTGATCATGGTGTTATCTG TACACTGGATAACCCTGTTTACCTTACCCGCGTGAAGGGTAAAACTGTTCATTGCCTTGACCGATCGGCACGTCC TCGCACAATTACCTTTGATCCGACGGAATACCGCTTCAAGCTGGCTTTGTTGAGGAATAATTATGAAGAGATGTT GTACATTATCCGGACGTCGAACCTCCTTGGTCAGAGCATCATAGCGTATTTGCAGAAAAAGGGCTTCCCCGAGGT GAAAATTAAGTTATATTGTTTTAGCATAGACGTTAACACTTATTCCCCTCTCAGATCGCTCTTCACTTTGTTCAA GATACCAACACCCGCTTTGAACTCGCGATTGAGTGCGGTAACCTTGACGTTGCAATGGAGACTGCTAGAGAGATT GATCGACCTGATTGCTGGGAGAGGCTGGCTCAGCAAGCTTTGAAGCAAGGCAACCACAAGGTATATCCATGCACA TTCAACTCGTAGCTGTTATTTCTGAAACTGGGGCTAGGTCGTCGAGAAGGCGTACCAGCAAACCAAAAACTTTGA CAAATTGTCTTTCCTCTACCTCGCCACTGGTAGCACCGAAAAATTGTCTAAAATGCAAAAAATCGCTGATGCTCG TGGGGATCCCATGTCTCGTTTCCACAACGCGTTGTATGCGGGCGACGTTGCCGGTAGAATAGCTGTTCTGAGGGA GGTTGGTCTCCGTATGTGCCCTTCTTTTTCTTGGCATAACGTGTCTCATTACTTTGTTTAAGACCCCTTGGCATA TCTCACAGCAAAGGGCAACGGCTTGGACGAGCTTGCAGCTGAGATCCTCGAAGCTGCTGGTCTTACGGAAGCTGA CATCGACGATGTCCCGATATTTGGAGCATCGACACTCCGACCTCCGCCAGTTGTTACCTCGACGGAAAACTACAA TTGGCCTATACTTTCACAAGGAGAAAACTACTTTGATCGTGCGTTAGCGAATGGAAGTTTGGAAGGTGGTGTGGA GCCTGCGTATGTTAATGGGGATGCTAATGCAGCAGCATCCTCTGCATTGGATGCTTGGGCTAGGGATGAAGAAAT TCAGGATGAGATTGATCCTGAGGAGGGCGGATGGGAATTGGATGCGGACGCAGATGAATTCAAGGAGGACGAAGC TGCTGAAGAGGTTGTAGAGGAGGAACAAGAGTTAGGTGCGGGTGCGGCACCTGGTGTGGATGAGACAGAGTTGTG GGTACGGAACTCACCATTGGCGGCCGACCATGTGGCTGCGGGATCATTCGAGTCTGCTATGCAGGTGAGTTATTC TCAAATCTTTGTTCTGACATTAGGGCTTATGCTTTTTGTTAGCTGCTTAACCGACAGTTTGGTATAAGTAACTTT GCACCACTTAAACCTCTCTTCTTGTCGATATACCGCTCTTCACATGTTTATCTTTCGCCCGTTGCGTCTCTCCCT CCTTTGAAATTGCACGTGAGGCGTAATATCGGAGAATCTGCACCTAGCAAAGTGCTACCCGTCGCTGCGCGCTCA ATACAGTCTGTGCGGTCAGAATTGGCGGAGGGCTATAGATCAGTATCGAGCAATAAGCTTACGGAAGCACAAGCG ACGTTCCGTTCAGTGCTGCAGGCACTGCTATTAGTTGTCATTGCATCAGATGATGAAGCTAAGCAGGTGCGTATC TATAAAACATGCTTCAATCTATGTTATCTGATAACACTCTTGAAGTGGAGAGATACTGTGACTTCTGCTCGGGAA TACTTGCTCGGCGTCTCCATTGAACTTGAGCGGAGGCGCGTTGTGGAACAGGAACCTGATAACCTGCGGAGAAAC CTTGAACTTGCAGCATATTTCACGCACTGTCAATTGCAACCTCCACAGTTACAAATTGCACTTCGTAGTGCCATT GGTGCATTTGCTAAGGCGAATAACCAAGCACATGCTGCGCGCTTCGCGAAACGGTTATTGGAGCTTAATCCTGAT CCAAAGATTGCTGCACAGGTATGGAGTCCACTTGAAAACAATTGCACGTTTCGCACTCTGATCTGATGCCCACTT TTTTGTGTTTCTTTTTTAAACGTGTTTTTGTATTCGGGGAACAAAGGCAAGACAACGAATTGCTGCCGGAGATCG TAATCCAAGAAATACGGTAGAGATTTCGTATGACGAATTTACGTCATTTGATATTTGTGCTGCGACGTATACGCC GATTTATAAAGGTTCACCGTCGGTGCATTGTCCGTATACGGATGCAGCGTACTTGCCAGAGTGTCAAGGAAAGCT TGACCCGTTGATGGAGTTGACTGAGATTGGCGCTCCGGCTGCTGGACTGCCTGCTGCGTGGTGA |