Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|699750
Gene name
Locationscaffold_08:920835..923228
Strand+
Gene length (bp)2393
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 9.4E-17 101 246
PF00005 ABC_tran ABC transporter 1.1E-12 371 490
PF04068 RLI Possible Fer4-like domain in RNase L inhibitor, RLI 6.4E-14 6 37
PF00037 Fer4 4Fe-4S binding domain 2.2E-07 50 71

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LPJ4|AB2E_ARATH ABC transporter E family member 2 OS=Arabidopsis thaliana GN=ABCE2 PE=2 SV=1 1 600 0.0E+00
sp|P61222|ABCE1_MOUSE ATP-binding cassette sub-family E member 1 OS=Mus musculus GN=Abce1 PE=1 SV=1 1 600 0.0E+00
sp|P61221|ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens GN=ABCE1 PE=1 SV=1 1 600 0.0E+00
sp|Q03195|RLI1_YEAST Translation initiation factor RLI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLI1 PE=1 SV=1 1 600 0.0E+00
sp|O60102|RLI1_SCHPO Translation initiation factor rli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rli1 PE=3 SV=1 1 600 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LPJ4|AB2E_ARATH ABC transporter E family member 2 OS=Arabidopsis thaliana GN=ABCE2 PE=2 SV=1 1 600 0.0E+00
sp|P61222|ABCE1_MOUSE ATP-binding cassette sub-family E member 1 OS=Mus musculus GN=Abce1 PE=1 SV=1 1 600 0.0E+00
sp|P61221|ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens GN=ABCE1 PE=1 SV=1 1 600 0.0E+00
sp|Q03195|RLI1_YEAST Translation initiation factor RLI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLI1 PE=1 SV=1 1 600 0.0E+00
sp|O60102|RLI1_SCHPO Translation initiation factor rli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rli1 PE=3 SV=1 1 600 0.0E+00
sp|Q9LID6|AB1E_ARATH ABC transporter E family member 1 OS=Arabidopsis thaliana GN=ABCE1 PE=2 SV=1 1 600 0.0E+00
sp|Q58129|Y719_METJA Uncharacterized ABC transporter ATP-binding protein MJ0719 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0719 PE=3 SV=1 1 600 0.0E+00
sp|Q9M0D0|AB3E_ARATH ABC transporter E family member 3 OS=Arabidopsis thaliana GN=ABCE3 PE=2 SV=1 355 522 3.0E-52
sp|Q73R11|Y282_TREDE Putative ABC transporter ATP-binding protein TDE_0282 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0282 PE=3 SV=1 103 542 1.0E-22
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 194 546 4.0E-18
sp|Q98DT6|SSUB1_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium loti (strain MAFF303099) GN=ssuB1 PE=3 SV=1 336 536 1.0E-15
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 371 536 1.0E-15
sp|Q73P93|Y906_TREDE Putative ABC transporter ATP-binding protein TDE_0906 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0906 PE=3 SV=1 200 537 3.0E-15
sp|Q8X5N2|HMUV_ECO57 Hemin import ATP-binding protein HmuV OS=Escherichia coli O157:H7 GN=hmuV PE=3 SV=3 351 578 1.0E-14
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 351 538 2.0E-14
sp|Q8FCJ1|HMUV_ECOL6 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hmuV PE=3 SV=2 351 578 7.0E-14
sp|Q0TBU8|HMUV_ECOL5 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hmuV PE=3 SV=1 351 578 7.0E-14
sp|P77622|DDPF_ECOLI Probable D,D-dipeptide transport ATP-binding protein DdpF OS=Escherichia coli (strain K12) GN=ddpF PE=2 SV=1 73 292 8.0E-14
sp|Q6DB87|RBSA_PECAS Ribose import ATP-binding protein RbsA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rbsA PE=3 SV=1 102 537 8.0E-14
sp|Q1M8R6|UGPC2_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC2 PE=3 SV=1 343 538 1.0E-13
sp|Q1R597|HMUV_ECOUT Hemin import ATP-binding protein HmuV OS=Escherichia coli (strain UTI89 / UPEC) GN=hmuV PE=3 SV=2 351 578 1.0E-13
sp|Q2K1C8|UGPC3_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC3 PE=3 SV=1 343 538 1.0E-13
sp|Q2K6L3|UGPC1_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC1 PE=3 SV=1 361 538 1.0E-13
sp|Q32AY3|HMUV_SHIDS Hemin import ATP-binding protein HmuV OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hmuV PE=3 SV=1 351 578 2.0E-13
sp|O70014|HMUV_SHIDY Hemin import ATP-binding protein HmuV OS=Shigella dysenteriae GN=hmuV PE=1 SV=1 351 578 3.0E-13
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 371 537 3.0E-13
sp|Q138A9|HMUV_RHOPS Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB5) GN=hmuV PE=3 SV=1 102 292 4.0E-13
sp|P54933|SMOK_RHOSH ATP-binding transport protein SmoK OS=Rhodobacter sphaeroides GN=smoK PE=3 SV=2 373 537 4.0E-13
sp|Q13RD3|SSUB2_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia xenovorans (strain LB400) GN=ssuB2 PE=3 SV=1 373 552 5.0E-13
sp|Q47087|CBRD_DICD3 Achromobactin transport ATP-binding protein CbrD OS=Dickeya dadantii (strain 3937) GN=cbrD PE=3 SV=2 103 294 5.0E-13
sp|Q3SQ65|HMUV_NITWN Hemin import ATP-binding protein HmuV OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hmuV PE=3 SV=1 103 292 6.0E-13
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 371 538 6.0E-13
sp|Q0BUR6|SSUB_GRABC Aliphatic sulfonates import ATP-binding protein SsuB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ssuB PE=3 SV=1 349 559 7.0E-13
sp|Q9M0D0|AB3E_ARATH ABC transporter E family member 3 OS=Arabidopsis thaliana GN=ABCE3 PE=2 SV=1 104 265 9.0E-13
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 373 563 9.0E-13
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 102 285 1.0E-12
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 351 548 1.0E-12
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 361 538 1.0E-12
sp|Q217B2|HMUV_RHOPB Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB18) GN=hmuV PE=3 SV=1 374 550 2.0E-12
sp|Q8X6U5|UGPC_ECO57 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2 372 541 2.0E-12
sp|P10907|UGPC_ECOLI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) GN=ugpC PE=1 SV=3 372 541 2.0E-12
sp|Q3YW77|UGPC_SHISS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2 372 541 2.0E-12
sp|Q2J3T0|HMUV_RHOP2 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain HaA2) GN=hmuV PE=3 SV=1 103 292 2.0E-12
sp|Q31VH5|UGPC_SHIBS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella boydii serotype 4 (strain Sb227) GN=ugpC PE=3 SV=2 372 541 2.0E-12
sp|Q93SH7|HMUV_BRADU Hemin import ATP-binding protein HmuV OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hmuV PE=3 SV=1 103 293 2.0E-12
sp|Q97X60|Y1893_SULSO Putative ABC transporter ATP-binding protein SSO1893 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1893 PE=3 SV=1 103 540 2.0E-12
sp|Q93SH7|HMUV_BRADU Hemin import ATP-binding protein HmuV OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hmuV PE=3 SV=1 344 538 3.0E-12
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 101 291 3.0E-12
sp|Q84EY8|HMUV_ENTCL Hemin import ATP-binding protein HmuV OS=Enterobacter cloacae GN=hmuV PE=3 SV=1 350 537 3.0E-12
sp|Q92WD6|UGPC_RHIME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium meliloti (strain 1021) GN=ugpC PE=3 SV=1 343 538 3.0E-12
sp|Q0TC10|UGPC_ECOL5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1 372 541 3.0E-12
sp|Q1R5H8|UGPC_ECOUT sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2 372 541 3.0E-12
sp|A1AGY1|UGPC_ECOK1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1 372 541 3.0E-12
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 351 536 3.0E-12
sp|Q8FCQ2|UGPC_ECOL6 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2 372 541 3.0E-12
sp|Q47087|CBRD_DICD3 Achromobactin transport ATP-binding protein CbrD OS=Dickeya dadantii (strain 3937) GN=cbrD PE=3 SV=2 374 571 4.0E-12
sp|Q8UII7|UGPC1_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1 373 538 4.0E-12
sp|Q4KGX6|SSUB1_PSEF5 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ssuB1 PE=3 SV=1 359 536 4.0E-12
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 103 291 4.0E-12
sp|Q8UB29|UGPC3_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1 371 537 4.0E-12
sp|Q8TQW9|Y1418_METAC Putative ABC transporter ATP-binding protein MA_1418 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1418 PE=3 SV=1 101 546 4.0E-12
sp|Q13GD4|SSUB3_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Burkholderia xenovorans (strain LB400) GN=ssuB3 PE=3 SV=1 373 554 4.0E-12
sp|Q1M589|UGPC3_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC3 PE=3 SV=1 343 538 5.0E-12
sp|Q32K28|THIQ_SHIDS Thiamine import ATP-binding protein ThiQ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thiQ PE=3 SV=1 362 566 5.0E-12
sp|A1B9H9|SSUB1_PARDP Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=ssuB1 PE=3 SV=1 359 537 5.0E-12
sp|Q0T8D1|THIQ_SHIF8 Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri serotype 5b (strain 8401) GN=thiQ PE=3 SV=1 343 566 5.0E-12
sp|Q6LQ77|BTUD_PHOPR Vitamin B12 import ATP-binding protein BtuD OS=Photobacterium profundum GN=btuD PE=3 SV=1 103 296 6.0E-12
sp|A0K3S5|UGPC_BURCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain HI2424) GN=ugpC PE=3 SV=1 351 537 6.0E-12
sp|Q1BRZ8|UGPC_BURCA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain AU 1054) GN=ugpC PE=3 SV=1 351 537 6.0E-12
sp|Q5NN23|SSUB_ZYMMO Aliphatic sulfonates import ATP-binding protein SsuB OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ssuB PE=3 SV=1 373 537 6.0E-12
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 343 537 7.0E-12
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 374 546 7.0E-12
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 347 561 7.0E-12
sp|P9WQI3|SUGC_MYCTU Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sugC PE=1 SV=1 341 552 7.0E-12
sp|P9WQI2|SUGC_MYCTO Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sugC PE=3 SV=1 341 552 7.0E-12
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 351 538 7.0E-12
sp|Q8UBB7|UGPC2_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC2 PE=3 SV=2 356 537 8.0E-12
sp|Q8Z245|UGPC_SALTI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhi GN=ugpC PE=3 SV=1 354 536 9.0E-12
sp|P23878|FEPC_ECOLI Ferric enterobactin transport ATP-binding protein FepC OS=Escherichia coli (strain K12) GN=fepC PE=2 SV=2 359 578 9.0E-12
sp|Q3SQ65|HMUV_NITWN Hemin import ATP-binding protein HmuV OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hmuV PE=3 SV=1 361 556 1.0E-11
sp|Q8D3S8|HMUV_VIBVU Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain CMCP6) GN=hmuV PE=3 SV=1 370 579 1.0E-11
sp|Q2L0H5|UGPC_BORA1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella avium (strain 197N) GN=ugpC PE=3 SV=1 373 545 1.0E-11
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 356 538 1.0E-11
sp|Q0BIZ6|UGPC_BURCM sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ugpC PE=3 SV=1 371 537 1.0E-11
sp|Q7MMN0|ZNUC_VIBVY Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain YJ016) GN=znuC PE=3 SV=1 91 291 1.0E-11
sp|Q8DFQ4|ZNUC_VIBVU Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain CMCP6) GN=znuC PE=3 SV=1 91 291 1.0E-11
sp|Q5PJL1|UGPC_SALPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ugpC PE=3 SV=1 372 536 1.0E-11
sp|P31548|THIQ_ECOLI Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain K12) GN=thiQ PE=1 SV=2 362 566 2.0E-11
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 371 563 2.0E-11
sp|Q6FFL0|ZNUC_ACIAD Zinc import ATP-binding protein ZnuC OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=znuC PE=3 SV=1 79 323 2.0E-11
sp|O32188|YUSV_BACSU Probable siderophore transport system ATP-binding protein YusV OS=Bacillus subtilis (strain 168) GN=yusV PE=1 SV=1 103 280 2.0E-11
sp|A3PRY1|UGPC_RHOS1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1 371 552 2.0E-11
sp|Q326G9|THIQ_SHIBS Thiamine import ATP-binding protein ThiQ OS=Shigella boydii serotype 4 (strain Sb227) GN=thiQ PE=3 SV=1 362 566 2.0E-11
sp|Q3IX40|UGPC_RHOS4 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1 371 552 2.0E-11
sp|Q4ZQE3|SSUB2_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB2 PE=3 SV=1 357 536 2.0E-11
sp|Q6CZ34|UGPC_PECAS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ugpC PE=3 SV=1 372 536 2.0E-11
sp|Q0S6U9|SSUB2_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhodococcus jostii (strain RHA1) GN=ssuB2 PE=3 SV=1 373 559 2.0E-11
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 350 564 2.0E-11
sp|Q2YKR8|UGPC_BRUA2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1 341 537 2.0E-11
sp|Q8XZX8|UGPC_RALSO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ralstonia solanacearum (strain GMI1000) GN=ugpC PE=3 SV=1 373 538 2.0E-11
sp|Q57IS3|UGPC_SALCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella choleraesuis (strain SC-B67) GN=ugpC PE=3 SV=1 372 536 2.0E-11
sp|Q3Z5U5|THIQ_SHISS Thiamine import ATP-binding protein ThiQ OS=Shigella sonnei (strain Ss046) GN=thiQ PE=3 SV=1 362 566 2.0E-11
sp|Q89ER4|SSUB_BRADU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuB PE=3 SV=1 356 550 3.0E-11
sp|Q8FW07|UGPC_BRUSU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1 341 537 3.0E-11
sp|Q578E9|UGPC_BRUAB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1 341 537 3.0E-11
sp|Q8ZLF4|UGPC_SALTY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ugpC PE=1 SV=1 372 536 3.0E-11
sp|Q164Y5|UGPC_ROSDO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ugpC PE=3 SV=1 351 563 3.0E-11
sp|Q6N7Y6|HMUV_RHOPA Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hmuV PE=3 SV=1 371 552 3.0E-11
sp|Q6N7Y6|HMUV_RHOPA Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hmuV PE=3 SV=1 103 293 3.0E-11
sp|Q66FU4|UGPC_YERPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ugpC PE=3 SV=1 351 536 3.0E-11
sp|Q664X5|MALK_YERPS Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=malK PE=3 SV=1 373 563 3.0E-11
sp|Q1CNR8|MALK_YERPN Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=malK PE=3 SV=1 373 563 3.0E-11
sp|Q8ZAS8|MALK_YERPE Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis GN=malK PE=3 SV=1 373 563 3.0E-11
sp|Q1CC21|MALK_YERPA Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=malK PE=3 SV=1 373 563 3.0E-11
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 373 563 3.0E-11
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 373 563 3.0E-11
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 373 563 3.0E-11
sp|Q1CNC6|UGPC_YERPN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ugpC PE=3 SV=1 351 536 3.0E-11
sp|Q74R28|UGPC_YERPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis GN=ugpC PE=3 SV=1 351 536 3.0E-11
sp|Q1CBH2|UGPC_YERPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ugpC PE=3 SV=1 351 536 3.0E-11
sp|P23878|FEPC_ECOLI Ferric enterobactin transport ATP-binding protein FepC OS=Escherichia coli (strain K12) GN=fepC PE=2 SV=2 103 294 4.0E-11
sp|Q8YCB1|UGPC_BRUME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1 341 537 4.0E-11
sp|Q57243|Y1272_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1272 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1272 PE=3 SV=1 87 291 4.0E-11
sp|Q8XA06|THIQ_ECO57 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O157:H7 GN=thiQ PE=3 SV=1 362 566 5.0E-11
sp|Q4ZTG9|SSUB1_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB1 PE=3 SV=1 340 548 5.0E-11
sp|Q2SMT0|RGMG_HAHCH Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Hahella chejuensis (strain KCTC 2396) GN=HCH_01167 PE=3 SV=1 101 537 5.0E-11
sp|O06476|YFMR_BACSU Uncharacterized ABC transporter ATP-binding protein YfmR OS=Bacillus subtilis (strain 168) GN=yfmR PE=3 SV=1 106 543 5.0E-11
sp|Q2SPI3|ZNUC1_HAHCH Zinc import ATP-binding protein ZnuC 1 OS=Hahella chejuensis (strain KCTC 2396) GN=znuC1 PE=3 SV=1 371 536 5.0E-11
sp|Q03ZL5|ECFA2_LEUMM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ecfA2 PE=1 SV=1 94 292 5.0E-11
sp|O32188|YUSV_BACSU Probable siderophore transport system ATP-binding protein YusV OS=Bacillus subtilis (strain 168) GN=yusV PE=1 SV=1 362 571 6.0E-11
sp|Q13TV1|UGPC_BURXL sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia xenovorans (strain LB400) GN=ugpC PE=3 SV=1 372 536 6.0E-11
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 79 290 6.0E-11
sp|Q48FT0|SSUB2_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB2 PE=3 SV=1 357 536 6.0E-11
sp|Q4FQ27|ZNUC_PSYA2 Zinc import ATP-binding protein ZnuC OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=znuC PE=3 SV=1 374 552 6.0E-11
sp|Q5WCI1|SSUB2_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Bacillus clausii (strain KSM-K16) GN=ssuB2 PE=3 SV=1 350 537 6.0E-11
sp|Q07LU3|HMUV_RHOP5 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisA53) GN=hmuV PE=3 SV=1 354 568 7.0E-11
sp|Q83MG3|THIQ_SHIFL Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri GN=thiQ PE=3 SV=4 362 535 7.0E-11
sp|Q0RKH4|SSUB2_FRAAA Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Frankia alni (strain ACN14a) GN=ssuB2 PE=3 SV=1 371 537 7.0E-11
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 103 305 7.0E-11
sp|Q46ZM0|UGPC_CUPPJ sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ugpC PE=3 SV=1 351 538 7.0E-11
sp|Q7MFA1|HMUV_VIBVY Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain YJ016) GN=hmuV PE=3 SV=1 370 572 7.0E-11
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 364 548 7.0E-11
sp|Q9Z8J5|Y348_CHLPN Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 OS=Chlamydia pneumoniae GN=CPn_0348 PE=3 SV=1 71 290 8.0E-11
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 364 537 9.0E-11
sp|Q73P93|Y906_TREDE Putative ABC transporter ATP-binding protein TDE_0906 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0906 PE=3 SV=1 374 542 1.0E-10
sp|Q885N4|SSUB1_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB1 PE=3 SV=1 357 536 1.0E-10
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 373 541 1.0E-10
sp|Q972J5|Y1136_SULTO Putative ABC transporter ATP-binding protein STK_11360 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_11360 PE=3 SV=1 208 533 1.0E-10
sp|Q39KB9|UGPC_BURL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ugpC PE=3 SV=1 371 537 1.0E-10
sp|Q1RGD0|THIQ_ECOUT Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain UTI89 / UPEC) GN=thiQ PE=3 SV=2 362 535 1.0E-10
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 354 539 1.0E-10
sp|Q0TLS2|THIQ_ECOL5 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thiQ PE=3 SV=1 362 535 1.0E-10
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 91 287 2.0E-10
sp|Q2SU77|UGPC_BURTA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ugpC PE=3 SV=1 371 537 2.0E-10
sp|Q5E5I1|HMUV_VIBF1 Hemin import ATP-binding protein HmuV OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hmuV PE=3 SV=1 101 291 2.0E-10
sp|Q3JMW7|UGPC_BURP1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia pseudomallei (strain 1710b) GN=ugpC PE=3 SV=1 371 537 2.0E-10
sp|Q8FL82|THIQ_ECOL6 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thiQ PE=3 SV=2 362 535 2.0E-10
sp|Q6CYU2|SSUB_PECAS Aliphatic sulfonates import ATP-binding protein SsuB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ssuB PE=3 SV=1 347 537 2.0E-10
sp|Q97WT4|Y2030_SULSO Putative ABC transporter ATP-binding protein SSO2030 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2030 PE=3 SV=1 103 540 2.0E-10
sp|Q6F813|MACB_ACIAD Macrolide export ATP-binding/permease protein MacB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=macB PE=3 SV=1 103 294 2.0E-10
sp|Q63Q62|UGPC_BURPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia pseudomallei (strain K96243) GN=ugpC PE=3 SV=1 371 537 2.0E-10
sp|Q1Q889|ZNUC_PSYCK Zinc import ATP-binding protein ZnuC OS=Psychrobacter cryohalolentis (strain K5) GN=znuC PE=3 SV=2 374 552 2.0E-10
sp|Q8SRV5|ABCF3_ENCCU Probable ATP-binding cassette sub-family F member 3 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_1190 PE=3 SV=1 103 508 2.0E-10
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 359 563 2.0E-10
sp|Q87RE5|ZNUC_VIBPA Zinc import ATP-binding protein ZnuC OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=znuC PE=3 SV=1 103 292 2.0E-10
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 373 536 2.0E-10
sp|Q7WID6|UGPC_BORBR sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ugpC PE=3 SV=1 372 540 2.0E-10
sp|Q7W6G5|UGPC_BORPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ugpC PE=3 SV=1 372 540 2.0E-10
sp|Q7VYN2|UGPC_BORPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ugpC PE=3 SV=1 372 540 2.0E-10
sp|Q5YRK2|SSUB3_NOCFA Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Nocardia farcinica (strain IFM 10152) GN=ssuB3 PE=3 SV=1 374 537 2.0E-10
sp|Q62GB4|UGPC_BURMA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia mallei (strain ATCC 23344) GN=ugpC PE=3 SV=1 371 537 2.0E-10
sp|Q9KRT4|UGPC_VIBCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ugpC PE=3 SV=2 351 598 2.0E-10
sp|Q0K998|UGPC_CUPNH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ugpC PE=3 SV=1 371 537 2.0E-10
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 359 536 2.0E-10
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 103 326 3.0E-10
sp|Q2K6L3|UGPC1_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC1 PE=3 SV=1 103 324 3.0E-10
sp|Q138A9|HMUV_RHOPS Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB5) GN=hmuV PE=3 SV=1 364 573 3.0E-10
sp|Q6D8T5|MACB_PECAS Macrolide export ATP-binding/permease protein MacB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=macB PE=3 SV=1 81 283 3.0E-10
sp|Q1MEG2|ZNUC_RHIL3 Zinc import ATP-binding protein ZnuC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=znuC PE=3 SV=1 103 293 3.0E-10
sp|P9WQK3|ETTA_MYCTU Energy-dependent translational throttle protein EttA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ettA PE=1 SV=1 102 538 3.0E-10
sp|P9WQK2|ETTA_MYCTO Energy-dependent translational throttle protein EttA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ettA PE=3 SV=1 102 538 3.0E-10
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 359 563 3.0E-10
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 356 537 3.0E-10
sp|Q8RLB6|SSUB_DELAC Aliphatic sulfonates import ATP-binding protein SsuB OS=Delftia acidovorans GN=ssuB PE=3 SV=1 374 537 3.0E-10
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 368 536 3.0E-10
sp|Q45978|HFAC_CAUCR Holdfast attachment protein C OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hfaC PE=3 SV=2 108 545 3.0E-10
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 358 548 3.0E-10
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 361 553 4.0E-10
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 351 536 4.0E-10
sp|Q5QXD0|HMUV_IDILO Hemin import ATP-binding protein HmuV OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hmuV PE=3 SV=1 104 291 4.0E-10
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 373 537 4.0E-10
sp|P94420|YCLP_BACSU Uncharacterized ABC transporter ATP-binding protein YclP OS=Bacillus subtilis (strain 168) GN=yclP PE=3 SV=1 99 291 4.0E-10
sp|Q3IWB5|ZNUC_RHOS4 Zinc import ATP-binding protein ZnuC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=znuC PE=3 SV=1 375 546 4.0E-10
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 351 561 4.0E-10
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 349 538 4.0E-10
sp|Q1R4I3|RBSA_ECOUT Ribose import ATP-binding protein RbsA OS=Escherichia coli (strain UTI89 / UPEC) GN=rbsA PE=3 SV=1 102 537 4.0E-10
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 218 543 4.0E-10
sp|Q0VTB6|ZNUC_ALCBS Zinc import ATP-binding protein ZnuC OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=znuC PE=3 SV=1 102 291 4.0E-10
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 373 536 4.0E-10
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 373 536 4.0E-10
sp|Q7MPC5|THIQ_VIBVY Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain YJ016) GN=thiQ PE=3 SV=1 349 532 5.0E-10
sp|Q8DE95|THIQ_VIBVU Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain CMCP6) GN=thiQ PE=3 SV=1 349 532 5.0E-10
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 354 547 5.0E-10
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 373 536 5.0E-10
sp|Q0SK28|SSUB1_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhodococcus jostii (strain RHA1) GN=ssuB1 PE=3 SV=1 356 539 5.0E-10
sp|Q47MA5|HMUV_THEFY Hemin import ATP-binding protein HmuV OS=Thermobifida fusca (strain YX) GN=hmuV PE=3 SV=1 101 299 5.0E-10
sp|Q1GID1|UGPC_RUEST sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1 369 538 5.0E-10
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 101 278 5.0E-10
sp|Q89WG0|UGPC_BRADU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ugpC PE=3 SV=1 103 293 5.0E-10
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 351 576 6.0E-10
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 362 538 6.0E-10
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 354 561 6.0E-10
sp|Q0RT43|SSUB1_FRAAA Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Frankia alni (strain ACN14a) GN=ssuB1 PE=3 SV=2 358 536 6.0E-10
sp|Q471U2|TAUB_CUPPJ Taurine import ATP-binding protein TauB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tauB PE=3 SV=1 354 541 6.0E-10
sp|P77481|YCJV_ECOLI Putative uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain K12) GN=ycjV PE=5 SV=2 108 326 6.0E-10
sp|Q04EY5|ECFA1_OENOB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA1 PE=3 SV=1 341 579 6.0E-10
sp|Q97KZ3|Y773_CLOAB Putative ABC transporter ATP-binding protein CA_C0773 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C0773 PE=3 SV=1 103 282 6.0E-10
sp|Q46ZU5|SSUB_CUPPJ Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuB PE=3 SV=1 374 569 6.0E-10
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 373 536 7.0E-10
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 373 536 7.0E-10
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 373 536 7.0E-10
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 373 536 7.0E-10
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 373 536 7.0E-10
sp|Q8XAW7|RBSA1_ECO57 Ribose import ATP-binding protein RbsA 1 OS=Escherichia coli O157:H7 GN=rbsA1 PE=3 SV=1 102 537 7.0E-10
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 218 547 7.0E-10
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 373 536 7.0E-10
sp|P9WQI3|SUGC_MYCTU Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sugC PE=1 SV=1 103 326 8.0E-10
sp|P9WQI2|SUGC_MYCTO Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sugC PE=3 SV=1 103 326 8.0E-10
sp|P04983|RBSA_ECOLI Ribose import ATP-binding protein RbsA OS=Escherichia coli (strain K12) GN=rbsA PE=1 SV=1 102 537 8.0E-10
sp|Q0TAW0|RBSA_ECOL5 Ribose import ATP-binding protein RbsA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rbsA PE=3 SV=1 102 537 8.0E-10
sp|Q2W4W1|ZNUC_MAGSA Zinc import ATP-binding protein ZnuC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=znuC PE=3 SV=1 103 291 8.0E-10
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 73 278 8.0E-10
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 373 536 8.0E-10
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 91 337 8.0E-10
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 346 521 9.0E-10
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 99 298 9.0E-10
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 358 550 9.0E-10
sp|Q58283|Y873_METJA Uncharacterized ABC transporter ATP-binding protein MJ0873 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0873 PE=3 SV=4 103 295 9.0E-10
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 374 536 9.0E-10
sp|Q2K1C8|UGPC3_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC3 PE=3 SV=1 103 324 1.0E-09
sp|Q2J3T0|HMUV_RHOP2 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain HaA2) GN=hmuV PE=3 SV=1 374 553 1.0E-09
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 103 326 1.0E-09
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 103 326 1.0E-09
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 103 326 1.0E-09
sp|Q8X8K4|YCJV_ECO57 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O157:H7 GN=ycjV PE=3 SV=1 108 326 1.0E-09
sp|Q48QM2|ECFA1_STRPM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA1 PE=3 SV=2 101 291 1.0E-09
sp|Q1JJC9|ECFA1_STRPC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA1 PE=3 SV=2 101 291 1.0E-09
sp|P0C0E8|ECFA1_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M1 GN=ecfA1 PE=3 SV=1 101 291 1.0E-09
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 356 560 1.0E-09
sp|P42065|APPF_BACSU Oligopeptide transport ATP-binding protein AppF OS=Bacillus subtilis (strain 168) GN=appF PE=3 SV=2 103 306 1.0E-09
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 101 291 1.0E-09
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 350 536 1.0E-09
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 356 560 1.0E-09
sp|Q1J982|ECFA1_STRPB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA1 PE=3 SV=2 101 291 1.0E-09
sp|Q1J982|ECFA1_STRPB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA1 PE=3 SV=2 347 567 1.0E-09
sp|Q7VMF9|MACB_HAEDU Macrolide export ATP-binding/permease protein MacB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=macB PE=3 SV=1 103 294 1.0E-09
sp|P0C0E9|ECFA_STRPY Energy-coupling factor transporter ATP-binding protein EcfA OS=Streptococcus pyogenes GN=ecfA PE=3 SV=1 101 291 1.0E-09
sp|P0CZ29|ECFA1_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA1 PE=3 SV=1 101 291 1.0E-09
sp|A2RH11|ECFA1_STRPG Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA1 PE=3 SV=1 101 291 1.0E-09
sp|Q1J449|ECFA1_STRPF Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA1 PE=3 SV=2 101 291 1.0E-09
sp|Q1JEC8|ECFA1_STRPD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA1 PE=3 SV=2 101 291 1.0E-09
sp|Q7CMM7|ECFA1_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA1 PE=3 SV=2 101 291 1.0E-09
sp|Q5X9B5|ECFA1_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA1 PE=3 SV=2 101 291 1.0E-09
sp|P0CZ28|ECFA1_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA1 PE=3 SV=1 101 291 1.0E-09
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 373 537 1.0E-09
sp|Q21CA3|UGPC_RHOPB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB18) GN=ugpC PE=3 SV=1 103 293 1.0E-09
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 356 560 1.0E-09
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 350 536 1.0E-09
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 373 536 1.0E-09
sp|Q2SB47|HMUV_HAHCH Hemin import ATP-binding protein HmuV OS=Hahella chejuensis (strain KCTC 2396) GN=hmuV PE=3 SV=1 374 557 1.0E-09
sp|Q8D954|UGPC_VIBVU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain CMCP6) GN=ugpC PE=3 SV=1 351 563 1.0E-09
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 354 574 1.0E-09
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 99 291 1.0E-09
sp|P63389|YHES_ECOLI Uncharacterized ABC transporter ATP-binding protein YheS OS=Escherichia coli (strain K12) GN=yheS PE=1 SV=1 102 294 1.0E-09
sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP-binding protein YheS OS=Escherichia coli O157:H7 GN=yheS PE=3 SV=1 102 294 1.0E-09
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 346 563 1.0E-09
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 103 306 1.0E-09
sp|Q7MLB8|UGPC_VIBVY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain YJ016) GN=ugpC PE=3 SV=2 351 563 1.0E-09
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 356 560 1.0E-09
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 99 291 1.0E-09
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 351 561 1.0E-09
sp|Q8FBS3|RBSA_ECOL6 Ribose import ATP-binding protein RbsA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rbsA PE=3 SV=1 102 537 1.0E-09
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 355 539 1.0E-09
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 101 292 1.0E-09
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 99 291 1.0E-09
sp|Q0BUR6|SSUB_GRABC Aliphatic sulfonates import ATP-binding protein SsuB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ssuB PE=3 SV=1 102 314 2.0E-09
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 102 296 2.0E-09
sp|Q8XZX8|UGPC_RALSO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ralstonia solanacearum (strain GMI1000) GN=ugpC PE=3 SV=1 103 293 2.0E-09
sp|Q1MEG2|ZNUC_RHIL3 Zinc import ATP-binding protein ZnuC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=znuC PE=3 SV=1 374 539 2.0E-09
sp|Q48QM2|ECFA1_STRPM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA1 PE=3 SV=2 347 567 2.0E-09
sp|Q1JJC9|ECFA1_STRPC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA1 PE=3 SV=2 347 567 2.0E-09
sp|P0C0E8|ECFA1_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M1 GN=ecfA1 PE=3 SV=1 347 567 2.0E-09
sp|P0C0E9|ECFA_STRPY Energy-coupling factor transporter ATP-binding protein EcfA OS=Streptococcus pyogenes GN=ecfA PE=3 SV=1 347 567 2.0E-09
sp|P0CZ29|ECFA1_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA1 PE=3 SV=1 347 567 2.0E-09
sp|A2RH11|ECFA1_STRPG Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA1 PE=3 SV=1 347 567 2.0E-09
sp|Q1J449|ECFA1_STRPF Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA1 PE=3 SV=2 347 567 2.0E-09
sp|Q1JEC8|ECFA1_STRPD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA1 PE=3 SV=2 347 567 2.0E-09
sp|Q7CMM7|ECFA1_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA1 PE=3 SV=2 347 567 2.0E-09
sp|Q5X9B5|ECFA1_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA1 PE=3 SV=2 347 567 2.0E-09
sp|P0CZ28|ECFA1_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA1 PE=3 SV=1 347 567 2.0E-09
sp|Q9HQ18|BTUDA_HALSA Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=btuD PE=1 SV=2 101 294 2.0E-09
sp|B0R5G4|BTUDA_HALS3 Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=btuD PE=3 SV=1 101 294 2.0E-09
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 356 541 2.0E-09
sp|Q3K506|SSUB_PSEPF Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1 357 537 2.0E-09
sp|Q07LQ4|SSUB_RHOP5 Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodopseudomonas palustris (strain BisA53) GN=ssuB PE=3 SV=1 356 537 2.0E-09
sp|Q8YDJ8|ZNUC_BRUME Zinc import ATP-binding protein ZnuC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=znuC PE=3 SV=1 364 545 2.0E-09
sp|Q7A169|POTA_STAAW Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MW2) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q6GAB5|POTA_STAAS Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MSSA476) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q6GHY6|POTA_STAAR Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MRSA252) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q7A679|POTA_STAAN Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain N315) GN=potA PE=1 SV=1 103 324 2.0E-09
sp|Q99V03|POTA_STAAM Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q5HGY5|POTA_STAAC Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain COL) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q2YX74|POTA_STAAB Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q2G2A7|POTA_STAA8 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain NCTC 8325) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q2FHY1|POTA_STAA3 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain USA300) GN=potA PE=3 SV=1 103 324 2.0E-09
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 349 538 2.0E-09
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 361 539 2.0E-09
sp|Q3KKA1|ZNUC_PSEPF Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf0-1) GN=znuC PE=3 SV=1 357 537 2.0E-09
sp|Q8FHR3|YCJV_ECOL6 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ycjV PE=3 SV=1 108 326 2.0E-09
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 354 547 2.0E-09
sp|Q1RC47|YCJV_ECOUT Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain UTI89 / UPEC) GN=ycjV PE=4 SV=1 108 326 2.0E-09
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 371 543 2.0E-09
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 78 292 2.0E-09
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 78 292 2.0E-09
sp|Q0TI47|YCJV_ECOL5 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ycjV PE=3 SV=2 108 326 2.0E-09
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 361 539 2.0E-09
sp|Q6LQC0|HMUV_PHOPR Hemin import ATP-binding protein HmuV OS=Photobacterium profundum GN=hmuV PE=3 SV=1 103 286 2.0E-09
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 97 279 2.0E-09
sp|Q87GB5|MALK_VIBPA Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=malK PE=3 SV=1 373 563 2.0E-09
sp|Q08972|NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEW1 PE=1 SV=1 68 401 2.0E-09
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 374 539 2.0E-09
sp|O32151|YURJ_BACSU Uncharacterized ABC transporter ATP-binding protein YurJ OS=Bacillus subtilis (strain 168) GN=yurJ PE=3 SV=1 104 326 2.0E-09
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 355 537 2.0E-09
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 103 326 2.0E-09
sp|Q03ZL6|ECFA1_LEUMM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ecfA1 PE=1 SV=1 350 547 2.0E-09
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 103 324 2.0E-09
sp|P77795|YDCT_ECOLI Uncharacterized ABC transporter ATP-binding protein YdcT OS=Escherichia coli (strain K12) GN=ydcT PE=3 SV=1 373 536 2.0E-09
sp|Q9WXX8|Y124_THEMA Probable metal transport system ATP-binding protein TM_0124 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0124 PE=3 SV=1 373 526 2.0E-09
sp|Q6FFZ1|SSUB_ACIAD Aliphatic sulfonates import ATP-binding protein SsuB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ssuB PE=3 SV=1 341 536 2.0E-09
sp|Q21JQ9|LOLD_SACD2 Lipoprotein-releasing system ATP-binding protein LolD OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lolD PE=3 SV=1 353 529 2.0E-09
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 83 280 2.0E-09
sp|Q2FRT7|ECFA2_METHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA2 PE=3 SV=1 340 552 2.0E-09
sp|Q21CA3|UGPC_RHOPB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB18) GN=ugpC PE=3 SV=1 351 538 3.0E-09
sp|Q2SB47|HMUV_HAHCH Hemin import ATP-binding protein HmuV OS=Hahella chejuensis (strain KCTC 2396) GN=hmuV PE=3 SV=1 102 291 3.0E-09
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 350 539 3.0E-09
sp|P48334|YCXD_CYAPA Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region OS=Cyanophora paradoxa PE=3 SV=1 75 283 3.0E-09
sp|Q881U6|SSUB2_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB2 PE=3 SV=1 374 548 3.0E-09
sp|Q321G6|BTUD_SHIBS Vitamin B12 import ATP-binding protein BtuD OS=Shigella boydii serotype 4 (strain Sb227) GN=btuD PE=3 SV=1 101 279 3.0E-09
sp|Q8DWR3|ECFA1_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA1 PE=3 SV=1 70 291 3.0E-09
sp|Q8E2L2|ECFA1_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA1 PE=3 SV=1 70 291 3.0E-09
sp|Q3JYF4|ECFA1_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA1 PE=3 SV=1 70 291 3.0E-09
sp|Q7MKU3|POTA_VIBVY Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2 359 537 3.0E-09
sp|Q8D9J4|POTA_VIBVU Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1 359 537 3.0E-09
sp|Q2K6Q4|ZNUC_RHIEC Zinc import ATP-binding protein ZnuC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=znuC PE=3 SV=1 103 294 3.0E-09
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 354 539 3.0E-09
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 356 539 3.0E-09
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 370 541 3.0E-09
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 99 291 3.0E-09
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 361 555 3.0E-09
sp|Q8KZQ6|SSUB_PSEPU Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1 357 537 3.0E-09
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 103 291 3.0E-09
sp|B5BA33|BTUD_SALPK Vitamin B12 import ATP-binding protein BtuD OS=Salmonella paratyphi A (strain AKU_12601) GN=btuD PE=3 SV=1 103 279 3.0E-09
sp|Q5PH81|BTUD_SALPA Vitamin B12 import ATP-binding protein BtuD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=btuD PE=3 SV=1 103 279 3.0E-09
sp|P63351|BTUD_SALTY Vitamin B12 import ATP-binding protein BtuD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|P63352|BTUD_SALTI Vitamin B12 import ATP-binding protein BtuD OS=Salmonella typhi GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|B4TGI0|BTUD_SALHS Vitamin B12 import ATP-binding protein BtuD OS=Salmonella heidelberg (strain SL476) GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|B5FJ99|BTUD_SALDC Vitamin B12 import ATP-binding protein BtuD OS=Salmonella dublin (strain CT_02021853) GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|Q57PU4|BTUD_SALCH Vitamin B12 import ATP-binding protein BtuD OS=Salmonella choleraesuis (strain SC-B67) GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 350 536 4.0E-09
sp|B5QVV9|BTUD_SALEP Vitamin B12 import ATP-binding protein BtuD OS=Salmonella enteritidis PT4 (strain P125109) GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 371 537 4.0E-09
sp|C3LLU1|BTUD_VIBCM Vitamin B12 import ATP-binding protein BtuD OS=Vibrio cholerae serotype O1 (strain M66-2) GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|Q9KSL1|BTUD_VIBCH Vitamin B12 import ATP-binding protein BtuD OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=btuD PE=3 SV=1 103 279 4.0E-09
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 101 324 4.0E-09
sp|Q6G194|UGPC_BARQU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella quintana (strain Toulouse) GN=ugpC PE=3 SV=1 373 548 4.0E-09
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 75 278 4.0E-09
sp|P57403|ZNUC_BUCAI Zinc import ATP-binding protein ZnuC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=znuC PE=3 SV=1 67 314 4.0E-09
sp|Q5DZC6|MALK_VIBF1 Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=malK PE=3 SV=1 374 563 4.0E-09
sp|Q7MFC4|MALK_VIBVY Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain YJ016) GN=malK PE=3 SV=1 103 341 4.0E-09
sp|Q8D3V0|MALK_VIBVU Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain CMCP6) GN=malK PE=3 SV=1 103 341 4.0E-09
sp|Q31I51|ZNUC_THICR Zinc import ATP-binding protein ZnuC OS=Thiomicrospira crunogena (strain XCL-2) GN=znuC PE=3 SV=1 78 291 4.0E-09
sp|Q07UI9|UGPC_RHOP5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisA53) GN=ugpC PE=3 SV=1 351 538 4.0E-09
sp|A0KE71|SSUB2_BURCH Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia cenocepacia (strain HI2424) GN=ssuB2 PE=3 SV=1 374 541 4.0E-09
sp|Q1BG75|SSUB2_BURCA Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=ssuB2 PE=3 SV=1 374 541 4.0E-09
sp|P06611|BTUD_ECOLI Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain K12) GN=btuD PE=1 SV=1 101 279 5.0E-09
sp|B1XG16|BTUD_ECODH Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain K12 / DH10B) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|C4ZYH1|BTUD_ECOBW Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 103 306 5.0E-09
sp|Q3Z257|BTUD_SHISS Vitamin B12 import ATP-binding protein BtuD OS=Shigella sonnei (strain Ss046) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q7C1M3|BTUD_SHIFL Vitamin B12 import ATP-binding protein BtuD OS=Shigella flexneri GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q0T4R9|BTUD_SHIF8 Vitamin B12 import ATP-binding protein BtuD OS=Shigella flexneri serotype 5b (strain 8401) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q32FJ0|BTUD_SHIDS Vitamin B12 import ATP-binding protein BtuD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B1LE21|BTUD_ECOSM Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B6I8R4|BTUD_ECOSE Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain SE11) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B7N547|BTUD_ECOLU Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B1IPL8|BTUD_ECOLC Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|A8A0Q1|BTUD_ECOHS Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O9:H4 (strain HS) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B7M1B8|BTUD_ECO8A Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O8 (strain IAI1) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B7NTS2|BTUD_ECO7I Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B7L6I2|BTUD_ECO55 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain 55989 / EAEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|A7ZMH7|BTUD_ECO24 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q3YVK8|RBSA_SHISS Ribose import ATP-binding protein RbsA OS=Shigella sonnei (strain Ss046) GN=rbsA PE=3 SV=1 102 537 5.0E-09
sp|Q576K0|ZNUC_BRUAB Zinc import ATP-binding protein ZnuC OS=Brucella abortus biovar 1 (strain 9-941) GN=znuC PE=3 SV=1 364 545 5.0E-09
sp|Q2YJH4|ZNUC_BRUA2 Zinc import ATP-binding protein ZnuC OS=Brucella abortus (strain 2308) GN=znuC PE=3 SV=1 364 545 5.0E-09
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 354 537 5.0E-09
sp|B2U358|BTUD_SHIB3 Vitamin B12 import ATP-binding protein BtuD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 103 324 5.0E-09
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 349 538 5.0E-09
sp|A1RG29|MACB_SHESW Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain W3-18-1) GN=macB PE=3 SV=1 99 283 5.0E-09
sp|Q1RB86|BTUD_ECOUT Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli (strain UTI89 / UPEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q8FH28|BTUD_ECOL6 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q0THB9|BTUD_ECOL5 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|A1ABP5|BTUD_ECOK1 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O1:K1 / APEC GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B7MV91|BTUD_ECO81 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O81 (strain ED1a) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B5YPZ7|BTUD_ECO5E Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q8X5W0|BTUD_ECO57 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O157:H7 GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B7MAS0|BTUD_ECO45 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|B7US48|BTUD_ECO27 Vitamin B12 import ATP-binding protein BtuD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=btuD PE=3 SV=1 101 279 5.0E-09
sp|Q13LX0|RBSA_BURXL Ribose import ATP-binding protein RbsA OS=Burkholderia xenovorans (strain LB400) GN=rbsA PE=3 SV=1 102 537 5.0E-09
sp|Q5E6M2|ZNUC1_VIBF1 Zinc import ATP-binding protein ZnuC 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=znuC1 PE=3 SV=1 104 291 5.0E-09
sp|Q2GFZ6|ZNUC_EHRCR Zinc import ATP-binding protein ZnuC OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=znuC PE=3 SV=1 375 541 5.0E-09
sp|Q81J16|ECFA1_BACCR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ecfA1 PE=3 SV=1 373 536 5.0E-09
sp|Q5QXD0|HMUV_IDILO Hemin import ATP-binding protein HmuV OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hmuV PE=3 SV=1 357 536 6.0E-09
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 362 544 6.0E-09
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 101 294 6.0E-09
sp|Q87GB5|MALK_VIBPA Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=malK PE=3 SV=1 103 326 6.0E-09
sp|O32151|YURJ_BACSU Uncharacterized ABC transporter ATP-binding protein YurJ OS=Bacillus subtilis (strain 168) GN=yurJ PE=3 SV=1 351 563 6.0E-09
sp|Q9KL34|HMUV_VIBCH Hemin import ATP-binding protein HmuV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hmuV PE=3 SV=2 374 552 6.0E-09
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 358 550 6.0E-09
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 70 324 6.0E-09
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 70 324 6.0E-09
sp|Q0A9E2|ZNUC_ALKEH Zinc import ATP-binding protein ZnuC OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=znuC PE=3 SV=1 364 536 6.0E-09
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 349 538 6.0E-09
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 346 521 6.0E-09
sp|Q66D26|PHNC_YERPS Phosphonates import ATP-binding protein PhnC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=phnC PE=3 SV=1 85 294 6.0E-09
sp|Q1CFV9|PHNC_YERPN Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=phnC PE=3 SV=2 85 294 6.0E-09
sp|Q8ZGU5|PHNC_YERPE Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis GN=phnC PE=3 SV=1 85 294 6.0E-09
sp|Q1C9L0|PHNC_YERPA Phosphonates import ATP-binding protein PhnC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=phnC PE=3 SV=2 85 294 6.0E-09
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 370 541 6.0E-09
sp|O34756|YJKB_BACSU Putative ABC transporter ATP-binding protein YjkB OS=Bacillus subtilis (strain 168) GN=yjkB PE=3 SV=1 368 533 6.0E-09
sp|Q6LK87|MALK_PHOPR Maltose/maltodextrin import ATP-binding protein MalK OS=Photobacterium profundum GN=malK PE=3 SV=2 103 326 6.0E-09
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 346 521 6.0E-09
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 83 326 7.0E-09
sp|Q8YDJ8|ZNUC_BRUME Zinc import ATP-binding protein ZnuC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=znuC PE=3 SV=1 103 308 7.0E-09
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 70 285 7.0E-09
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 103 294 7.0E-09
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 78 291 7.0E-09
sp|Q1QTX6|UGPC_CHRSD sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ugpC PE=3 SV=1 352 538 7.0E-09
sp|A0LCH8|ZNUC_MAGMM Zinc import ATP-binding protein ZnuC OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=znuC PE=3 SV=1 357 559 7.0E-09
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 354 535 7.0E-09
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 356 563 7.0E-09
sp|Q8EUF1|ECFA_MYCPE Energy-coupling factor transporter ATP-binding protein EcfA OS=Mycoplasma penetrans (strain HF-2) GN=ecfA PE=3 SV=1 373 567 7.0E-09
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 70 324 7.0E-09
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 70 324 7.0E-09
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 70 324 7.0E-09
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 70 324 7.0E-09
sp|Q03PY5|ECFA1_LACBA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ecfA1 PE=1 SV=1 342 536 7.0E-09
sp|O86751|FBPC_STRCO Fe(3+) ions import ATP-binding protein FbpC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fbpC PE=3 SV=1 351 537 7.0E-09
sp|Q8UII7|UGPC1_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1 101 293 8.0E-09
sp|Q8KZQ6|SSUB_PSEPU Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1 77 291 8.0E-09
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 355 536 8.0E-09
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 356 536 8.0E-09
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 372 533 8.0E-09
sp|P37313|DPPF_ECOLI Dipeptide transport ATP-binding protein DppF OS=Escherichia coli (strain K12) GN=dppF PE=3 SV=1 91 292 8.0E-09
sp|Q6D4E2|POTA_PECAS Spermidine/putrescine import ATP-binding protein PotA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=potA PE=3 SV=1 362 563 8.0E-09
sp|O29527|Y731_ARCFU Putative ABC transporter ATP-binding protein AF_0731 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0731 PE=3 SV=2 103 313 8.0E-09
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 342 561 8.0E-09
sp|Q28QL7|UGPC_JANSC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Jannaschia sp. (strain CCS1) GN=ugpC PE=3 SV=1 352 555 8.0E-09
sp|Q8ZNV7|ZNUC_SALTY Zinc import ATP-binding protein ZnuC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=znuC PE=2 SV=2 102 291 8.0E-09
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 361 553 8.0E-09
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 356 536 8.0E-09
sp|Q0TC10|UGPC_ECOL5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1 103 356 9.0E-09
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 350 565 9.0E-09
sp|Q4KKK4|ZNUC_PSEF5 Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=znuC PE=3 SV=1 362 536 9.0E-09
sp|P45094|DPPF_HAEIN Dipeptide transport ATP-binding protein DppF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dppF PE=3 SV=1 91 292 9.0E-09
sp|Q6G475|HMUV_BARHE Hemin import ATP-binding protein HmuV OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=hmuV PE=3 SV=1 373 547 9.0E-09
sp|Q7N545|ZNUC_PHOLL Zinc import ATP-binding protein ZnuC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=znuC PE=3 SV=2 357 545 9.0E-09
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 378 537 9.0E-09
sp|Q7CJG3|MACB2_YERPE Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis GN=macB2 PE=3 SV=1 99 288 9.0E-09
sp|Q1C5W7|MACB2_YERPA Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=macB2 PE=3 SV=1 99 288 9.0E-09
sp|Q1CJW8|MACB1_YERPN Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=macB1 PE=3 SV=1 99 288 9.0E-09
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 81 291 1.0E-08
sp|Q2L0H5|UGPC_BORA1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella avium (strain 197N) GN=ugpC PE=3 SV=1 103 340 1.0E-08
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 99 300 1.0E-08
sp|Q2K6Q4|ZNUC_RHIEC Zinc import ATP-binding protein ZnuC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=znuC PE=3 SV=1 361 539 1.0E-08
sp|Q8EUF1|ECFA_MYCPE Energy-coupling factor transporter ATP-binding protein EcfA OS=Mycoplasma penetrans (strain HF-2) GN=ecfA PE=3 SV=1 108 278 1.0E-08
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 356 570 1.0E-08
sp|Q88R93|SSUB_PSEPK Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1 357 537 1.0E-08
sp|Q73F67|ECFA1_BACC1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ecfA1 PE=3 SV=1 373 536 1.0E-08
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 350 521 1.0E-08
sp|Q38VW6|POTA_LACSS Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=potA PE=3 SV=1 356 563 1.0E-08
sp|Q8EB59|HMUV_SHEON Hemin import ATP-binding protein HmuV OS=Shewanella oneidensis (strain MR-1) GN=hmuV PE=3 SV=1 371 539 1.0E-08
sp|Q668L6|MACB2_YERPS Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=macB2 PE=3 SV=1 99 288 1.0E-08
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 70 324 1.0E-08
sp|Q03EE4|ECFA_PEDPA Energy-coupling factor transporter ATP-binding protein EcfA OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ecfA PE=3 SV=1 347 546 1.0E-08
sp|P72479|OPPF_STRMU Oligopeptide transport ATP-binding protein OppF OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=oppF PE=3 SV=2 103 294 1.0E-08
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 70 324 1.0E-08
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 70 324 1.0E-08
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 70 324 1.0E-08
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 103 398 1.0E-08
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 368 538 1.0E-08
sp|O34314|YTLC_BACSU Uncharacterized ABC transporter ATP-binding protein YtlC OS=Bacillus subtilis (strain 168) GN=ytlC PE=3 SV=1 344 589 1.0E-08
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 350 557 1.0E-08
sp|Q89AJ0|ZNUC_BUCBP Zinc import ATP-binding protein ZnuC OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=znuC PE=3 SV=1 368 582 1.0E-08
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 349 521 1.0E-08
sp|Q6NDQ0|UGPC_RHOPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ugpC PE=3 SV=1 343 554 1.0E-08
sp|Q5PIA5|ZNUC_SALPA Zinc import ATP-binding protein ZnuC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=znuC PE=3 SV=1 102 291 1.0E-08
sp|Q57NA5|ZNUC_SALCH Zinc import ATP-binding protein ZnuC OS=Salmonella choleraesuis (strain SC-B67) GN=znuC PE=3 SV=2 102 291 1.0E-08
sp|P0A2U9|AMIE_STRR6 Oligopeptide transport ATP-binding protein AmiE OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=amiE PE=3 SV=1 103 301 1.0E-08
sp|P0A2U8|AMIE_STRPN Oligopeptide transport ATP-binding protein AmiE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=amiE PE=3 SV=1 103 301 1.0E-08
sp|Q660M8|POTA_BORBP Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=potA PE=3 SV=1 349 563 1.0E-08
sp|Q217L2|MACB_RHOPB Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain BisB18) GN=macB PE=3 SV=1 99 280 1.0E-08
sp|Q8K9M6|ZNUC_BUCAP Zinc import ATP-binding protein ZnuC OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=znuC PE=3 SV=1 103 314 1.0E-08
sp|Q9KL04|MALK_VIBCH Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=malK PE=3 SV=1 373 563 1.0E-08
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 346 521 1.0E-08
sp|Q2NIT5|ECFA_AYWBP Energy-coupling factor transporter ATP-binding protein EcfA OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ecfA PE=3 SV=2 359 553 1.0E-08
sp|Q98L75|HMUV_RHILO Hemin import ATP-binding protein HmuV OS=Rhizobium loti (strain MAFF303099) GN=hmuV PE=3 SV=1 357 554 1.0E-08
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 346 521 1.0E-08
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 373 543 1.0E-08
sp|Q6HPN0|ECFA1_BACHK Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ecfA1 PE=3 SV=2 373 536 1.0E-08
sp|Q81VQ2|ECFA1_BACAN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus anthracis GN=ecfA1 PE=3 SV=1 373 536 1.0E-08
sp|A0R8K8|ECFA1_BACAH Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus thuringiensis (strain Al Hakam) GN=ecfA1 PE=3 SV=2 373 536 1.0E-08
sp|Q8UB29|UGPC3_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1 103 291 2.0E-08
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 99 291 2.0E-08
sp|P94420|YCLP_BACSU Uncharacterized ABC transporter ATP-binding protein YclP OS=Bacillus subtilis (strain 168) GN=yclP PE=3 SV=1 354 553 2.0E-08
sp|Q89WG0|UGPC_BRADU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ugpC PE=3 SV=1 373 554 2.0E-08
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 364 535 2.0E-08
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 99 300 2.0E-08
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 357 576 2.0E-08
sp|Q6G194|UGPC_BARQU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella quintana (strain Toulouse) GN=ugpC PE=3 SV=1 104 264 2.0E-08
sp|Q5DZC6|MALK_VIBF1 Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=malK PE=3 SV=1 103 326 2.0E-08
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 374 564 2.0E-08
sp|Q28QL7|UGPC_JANSC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Jannaschia sp. (strain CCS1) GN=ugpC PE=3 SV=1 103 291 2.0E-08
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 108 279 2.0E-08
sp|Q63H62|ECFA1_BACCZ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ZK / E33L) GN=ecfA1 PE=3 SV=2 373 536 2.0E-08
sp|P36947|RBSA_BACSU Ribose import ATP-binding protein RbsA OS=Bacillus subtilis (strain 168) GN=rbsA PE=3 SV=2 102 494 2.0E-08
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 347 561 2.0E-08
sp|Q3YSK9|ZNUC_EHRCJ Zinc import ATP-binding protein ZnuC OS=Ehrlichia canis (strain Jake) GN=znuC PE=3 SV=2 375 550 2.0E-08
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 372 567 2.0E-08
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 355 540 2.0E-08
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 361 536 2.0E-08
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 364 563 2.0E-08
sp|O51587|POTA_BORBU Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=potA PE=3 SV=1 349 563 2.0E-08
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 357 537 2.0E-08
sp|Q2SMN9|MACB_HAHCH Macrolide export ATP-binding/permease protein MacB OS=Hahella chejuensis (strain KCTC 2396) GN=macB PE=3 SV=1 102 277 2.0E-08
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 103 288 2.0E-08
sp|Q8H1R4|AB10I_ARATH ABC transporter I family member 10, chloroplastic OS=Arabidopsis thaliana GN=ABCI10 PE=2 SV=1 374 521 2.0E-08
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 352 561 2.0E-08
sp|Q8EIL8|MACB_SHEON Macrolide export ATP-binding/permease protein MacB OS=Shewanella oneidensis (strain MR-1) GN=macB PE=3 SV=1 103 288 2.0E-08
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 103 278 2.0E-08
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 288 537 2.0E-08
sp|P63402|Y2593_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb2593 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2593 PE=3 SV=1 102 281 2.0E-08
sp|P9WQI5|Y2564_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv2564 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2564 PE=1 SV=1 102 281 2.0E-08
sp|P9WQI4|Y2564_MYCTO Uncharacterized ABC transporter ATP-binding protein MT2640 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2640 PE=3 SV=1 102 281 2.0E-08
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 346 521 2.0E-08
sp|Q8UF79|ZNUC_AGRFC Zinc import ATP-binding protein ZnuC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=znuC PE=3 SV=1 361 552 2.0E-08
sp|Q0SML1|POTA_BORAP Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia afzelii (strain PKo) GN=potA PE=3 SV=1 349 563 2.0E-08
sp|D4GSY7|ANTRA_HALVD Probable anion import ATP-binding protein HVO_1886 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_1886 PE=3 SV=1 102 293 2.0E-08
sp|Q6YPR6|POTA_ONYPE Spermidine/putrescine import ATP-binding protein PotA OS=Onion yellows phytoplasma (strain OY-M) GN=potA PE=3 SV=1 389 563 2.0E-08
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 103 289 2.0E-08
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 345 536 2.0E-08
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 101 292 2.0E-08
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 101 324 2.0E-08
sp|P54954|YXEO_BACSU Probable amino-acid import ATP-binding protein YxeO OS=Bacillus subtilis (strain 168) GN=yxeO PE=1 SV=1 359 534 2.0E-08
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 291 537 2.0E-08
sp|Q5FL41|POTA_LACAC Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=potA PE=3 SV=1 346 561 2.0E-08
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 83 283 2.0E-08
sp|Q1M8R6|UGPC2_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC2 PE=3 SV=1 103 324 3.0E-08
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 101 324 3.0E-08
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 103 254 3.0E-08
sp|Q7VMF9|MACB_HAEDU Macrolide export ATP-binding/permease protein MacB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=macB PE=3 SV=1 349 558 3.0E-08
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 375 537 3.0E-08
sp|Q07UI9|UGPC_RHOP5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisA53) GN=ugpC PE=3 SV=1 103 324 3.0E-08
sp|Q8UF79|ZNUC_AGRFC Zinc import ATP-binding protein ZnuC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=znuC PE=3 SV=1 103 294 3.0E-08
sp|Q5E882|THIQ_VIBF1 Thiamine import ATP-binding protein ThiQ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thiQ PE=3 SV=1 81 289 3.0E-08
sp|P10907|UGPC_ECOLI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) GN=ugpC PE=1 SV=3 103 356 4.0E-08
sp|Q31VH5|UGPC_SHIBS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella boydii serotype 4 (strain Sb227) GN=ugpC PE=3 SV=2 103 356 4.0E-08
sp|Q1R5H8|UGPC_ECOUT sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2 103 356 4.0E-08
sp|A1AGY1|UGPC_ECOK1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1 103 356 4.0E-08
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 373 563 4.0E-08
sp|Q7MFC4|MALK_VIBVY Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain YJ016) GN=malK PE=3 SV=1 371 563 4.0E-08
sp|Q8D3V0|MALK_VIBVU Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain CMCP6) GN=malK PE=3 SV=1 371 563 4.0E-08
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 356 563 4.0E-08
sp|Q88R93|SSUB_PSEPK Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1 103 291 4.0E-08
sp|Q8FCQ2|UGPC_ECOL6 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2 103 356 5.0E-08
sp|A0K3S5|UGPC_BURCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain HI2424) GN=ugpC PE=3 SV=1 103 333 5.0E-08
sp|Q1BRZ8|UGPC_BURCA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain AU 1054) GN=ugpC PE=3 SV=1 103 333 5.0E-08
sp|Q1GID1|UGPC_RUEST sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1 103 336 5.0E-08
sp|Q164Y5|UGPC_ROSDO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ugpC PE=3 SV=1 103 291 6.0E-08
sp|Q6NDQ0|UGPC_RHOPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ugpC PE=3 SV=1 103 293 6.0E-08
sp|Q46ZM0|UGPC_CUPPJ sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ugpC PE=3 SV=1 103 293 7.0E-08
sp|Q9KL04|MALK_VIBCH Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=malK PE=3 SV=1 103 326 7.0E-08
sp|Q1Q889|ZNUC_PSYCK Zinc import ATP-binding protein ZnuC OS=Psychrobacter cryohalolentis (strain K5) GN=znuC PE=3 SV=2 103 296 8.0E-08
sp|Q9HQ18|BTUDA_HALSA Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=btuD PE=1 SV=2 373 554 8.0E-08
sp|B0R5G4|BTUDA_HALS3 Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=btuD PE=3 SV=1 373 554 8.0E-08
sp|Q6LK87|MALK_PHOPR Maltose/maltodextrin import ATP-binding protein MalK OS=Photobacterium profundum GN=malK PE=3 SV=2 372 563 8.0E-08
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 101 281 8.0E-08
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 103 293 1.0E-07
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 103 353 1.0E-07
sp|Q2SPI3|ZNUC1_HAHCH Zinc import ATP-binding protein ZnuC 1 OS=Hahella chejuensis (strain KCTC 2396) GN=znuC1 PE=3 SV=1 103 291 1.0E-07
sp|Q0VTB6|ZNUC_ALCBS Zinc import ATP-binding protein ZnuC OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=znuC PE=3 SV=1 354 537 1.0E-07
sp|Q0RT43|SSUB1_FRAAA Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Frankia alni (strain ACN14a) GN=ssuB1 PE=3 SV=2 102 291 1.0E-07
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 337 563 1.0E-07
sp|Q21JQ9|LOLD_SACD2 Lipoprotein-releasing system ATP-binding protein LolD OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lolD PE=3 SV=1 103 285 1.0E-07
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 103 254 1.0E-07
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 103 293 1.0E-07
sp|P54933|SMOK_RHOSH ATP-binding transport protein SmoK OS=Rhodobacter sphaeroides GN=smoK PE=3 SV=2 103 324 2.0E-07
sp|Q3YW77|UGPC_SHISS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2 103 335 2.0E-07
sp|Q1M589|UGPC3_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC3 PE=3 SV=1 103 293 2.0E-07
sp|Q5NN23|SSUB_ZYMMO Aliphatic sulfonates import ATP-binding protein SsuB OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ssuB PE=3 SV=1 103 291 2.0E-07
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 78 291 2.0E-07
sp|Q7MMN0|ZNUC_VIBVY Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain YJ016) GN=znuC PE=3 SV=1 357 548 2.0E-07
sp|Q8DFQ4|ZNUC_VIBVU Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain CMCP6) GN=znuC PE=3 SV=1 357 548 2.0E-07
sp|Q2YKR8|UGPC_BRUA2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1 103 291 2.0E-07
sp|Q8FW07|UGPC_BRUSU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1 103 291 2.0E-07
sp|Q578E9|UGPC_BRUAB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1 103 291 2.0E-07
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 349 537 2.0E-07
sp|Q5E5I1|HMUV_VIBF1 Hemin import ATP-binding protein HmuV OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hmuV PE=3 SV=1 375 574 2.0E-07
sp|Q7WID6|UGPC_BORBR sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ugpC PE=3 SV=1 103 345 2.0E-07
sp|Q7W6G5|UGPC_BORPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ugpC PE=3 SV=1 103 345 2.0E-07
sp|Q7VYN2|UGPC_BORPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ugpC PE=3 SV=1 103 345 2.0E-07
sp|Q0K998|UGPC_CUPNH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ugpC PE=3 SV=1 103 324 2.0E-07
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 103 291 2.0E-07
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 373 547 2.0E-07
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 103 291 2.0E-07
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 379 535 2.0E-07
sp|Q8ZNV7|ZNUC_SALTY Zinc import ATP-binding protein ZnuC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=znuC PE=2 SV=2 371 548 2.0E-07
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 91 281 2.0E-07
sp|Q5PIA5|ZNUC_SALPA Zinc import ATP-binding protein ZnuC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=znuC PE=3 SV=1 371 548 2.0E-07
sp|Q57NA5|ZNUC_SALCH Zinc import ATP-binding protein ZnuC OS=Salmonella choleraesuis (strain SC-B67) GN=znuC PE=3 SV=2 371 548 2.0E-07
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 103 353 3.0E-07
sp|Q8YCB1|UGPC_BRUME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1 103 334 3.0E-07
sp|Q04EY5|ECFA1_OENOB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA1 PE=3 SV=1 103 291 3.0E-07
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 356 563 3.0E-07
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 362 537 3.0E-07
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 362 537 3.0E-07
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 362 537 3.0E-07
sp|Q5E6M2|ZNUC1_VIBF1 Zinc import ATP-binding protein ZnuC 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=znuC1 PE=3 SV=1 364 548 3.0E-07
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 103 291 4.0E-07
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 375 552 4.0E-07
sp|Q92WD6|UGPC_RHIME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium meliloti (strain 1021) GN=ugpC PE=3 SV=1 103 293 4.0E-07
sp|Q3K506|SSUB_PSEPF Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1 78 291 4.0E-07
sp|Q6FFZ1|SSUB_ACIAD Aliphatic sulfonates import ATP-binding protein SsuB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ssuB PE=3 SV=1 101 291 4.0E-07
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 103 294 4.0E-07
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 103 277 5.0E-07
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 373 552 5.0E-07
sp|Q6CYU2|SSUB_PECAS Aliphatic sulfonates import ATP-binding protein SsuB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ssuB PE=3 SV=1 85 310 5.0E-07
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 108 254 5.0E-07
sp|Q8X6U5|UGPC_ECO57 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2 103 356 6.0E-07
sp|Q6FFL0|ZNUC_ACIAD Zinc import ATP-binding protein ZnuC OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=znuC PE=3 SV=1 371 536 6.0E-07
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 362 537 6.0E-07
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 101 291 6.0E-07
sp|Q5E882|THIQ_VIBF1 Thiamine import ATP-binding protein ThiQ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thiQ PE=3 SV=1 346 530 6.0E-07
sp|Q1CNC6|UGPC_YERPN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ugpC PE=3 SV=1 103 277 7.0E-07
sp|Q74R28|UGPC_YERPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis GN=ugpC PE=3 SV=1 103 277 7.0E-07
sp|Q1CBH2|UGPC_YERPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ugpC PE=3 SV=1 103 277 7.0E-07
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 103 294 7.0E-07
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 103 293 8.0E-07
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 103 324 9.0E-07
sp|Q13TV1|UGPC_BURXL sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia xenovorans (strain LB400) GN=ugpC PE=3 SV=1 82 256 1.0E-06
sp|Q97WT4|Y2030_SULSO Putative ABC transporter ATP-binding protein SSO2030 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2030 PE=3 SV=1 363 542 1.0E-06
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 103 339 1.0E-06
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 103 341 1.0E-06
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 103 341 1.0E-06
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 103 291 1.0E-06
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 103 291 1.0E-06
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 99 293 1.0E-06
sp|A0LCH8|ZNUC_MAGMM Zinc import ATP-binding protein ZnuC OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=znuC PE=3 SV=1 103 291 1.0E-06
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 354 563 1.0E-06
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 354 563 1.0E-06
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 354 563 1.0E-06
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 354 563 1.0E-06
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 364 521 1.0E-06
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 101 281 1.0E-06
sp|Q8D3S8|HMUV_VIBVU Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain CMCP6) GN=hmuV PE=3 SV=1 103 292 2.0E-06
sp|Q57243|Y1272_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1272 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1272 PE=3 SV=1 363 539 2.0E-06
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 103 341 2.0E-06
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 354 563 2.0E-06
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 354 563 2.0E-06
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 354 563 2.0E-06
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 354 563 2.0E-06
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 354 563 2.0E-06
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 354 563 2.0E-06
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 374 539 2.0E-06
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 103 296 3.0E-06
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 103 339 3.0E-06
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 103 339 3.0E-06
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 103 339 3.0E-06
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 103 339 3.0E-06
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 103 339 3.0E-06
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 103 339 3.0E-06
sp|Q2GFZ6|ZNUC_EHRCR Zinc import ATP-binding protein ZnuC OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=znuC PE=3 SV=1 103 278 3.0E-06
sp|Q2NIT5|ECFA_AYWBP Energy-coupling factor transporter ATP-binding protein EcfA OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ecfA PE=3 SV=2 99 292 3.0E-06
sp|Q9KRT4|UGPC_VIBCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ugpC PE=3 SV=2 103 331 4.0E-06
sp|Q3YSK9|ZNUC_EHRCJ Zinc import ATP-binding protein ZnuC OS=Ehrlichia canis (strain Jake) GN=znuC PE=3 SV=2 103 298 4.0E-06
sp|Q6D8T5|MACB_PECAS Macrolide export ATP-binding/permease protein MacB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=macB PE=3 SV=1 362 559 5.0E-06
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 90 291 5.0E-06
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 103 339 5.0E-06
sp|Q1QTX6|UGPC_CHRSD sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ugpC PE=3 SV=1 103 293 5.0E-06
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 350 562 6.0E-06
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 377 554 7.0E-06
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 368 563 7.0E-06
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 368 563 8.0E-06
sp|Q31I51|ZNUC_THICR Zinc import ATP-binding protein ZnuC OS=Thiomicrospira crunogena (strain XCL-2) GN=znuC PE=3 SV=1 338 494 9.0E-06
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 103 291 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0030554 adenyl nucleotide binding No
GO:0043167 ion binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|699750
MADKITRIAIVDANRCKPKRCAQECKKSCPVVKMGKLCIEVKPSDKIAFISEFLCIGCGICVKKCPFEAITIINL
PTNLESAVTHRYTANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRYDDPPDWEEILKYFRGS
ELQNYFTKVLEDNLKALIKPQYVDHIPRAIKGKQTVDQMLTSKTELDNKQRMCDELELNKVLEREVPQLSGGELQ
RFAIAMTCVQQADVYMFDEPSSYLDIKQRLKAAEVIRSLLHPDCYVVAVEHDLSVLDYLSDFICCLYGKPSVYGV
VTMPYSVREGINIFLDGFIPTENLRFREESLSFKMVETAEEIIVDKTRHYSYPSMTKTLGGFKLTVESGGFTDSE
IIVMLGENGTGKTTFVRLLAGDVPDDETDKQTFSVSLKPQTISPKFDGTVRQLLIKQIKAAFMHPQFQTDVLKPM
SLDNVMDQEVKTLSGGELQRVAIVLALGKPNAIYLLDEPSSFLDSEQRIIASKVIKRFILHSKKTAFVIEHDFIM
ATYLADRVIVFQGQPAVAATAAPPQSLLSGMNKFLASLEITFRRDPTNFRPRVNKLHSIKDREQKAAGNYFFLED
*
Coding >Agabi119p4|699750
ATGGCGGACAAGATAACCCGTATTGCTATCGTAGATGCAAATCGTTGCAAGCCGAAACGATGTGCACAAGAATGT
AAAAAGTCATGTCCAGTGGTGAAGATGGGAAAATTATGTATTGAGGTCAAGCCCTCGGACAAAATCGCATTTATC
TCAGAGTTTTTGTGTATCGGGTGTGGTATCTGCGTCAAAAAATGCCCATTCGAAGCCATCACAATCATCAATTTA
CCTACCAACTTGGAGTCAGCTGTTACGCACCGCTACACCGCGAACTCTTTCAAGCTACATCGATTGCCTACCCCT
CGTCCGGGTCAGGTTCTTGGTCTCGTTGGGACGAACGGAATCGGAAAGAGCACTGCCTTGAAGATCTTGGCTGGA
AAGCTCAAACCCAACCTAGGACGTTATGATGACCCACCCGATTGGGAGGAAATTTTGAAATATTTCCGAGGATCC
GAACTCCAGAACTACTTTACAAAGGTGCTTGAAGATAACTTGAAAGCGCTTATCAAACCGCAATATGTCGACCAT
ATTCCCAGAGCAATTAAGGGAAAGCAGACCGTTGATCAAATGCTTACTTCGAAAACGGAACTAGACAATAAGCAG
AGAATGTGTGATGAGCTTGAGCTCAACAAAGTTCTCGAACGAGAAGTCCCACAGTTGTCCGGTGGAGAGTTGCAA
AGATTTGCGATTGCCATGACTTGTGTCCAACAAGCCGATGTTTACATGTTTGATGAACCCTCAAGTTATCTTGAT
ATCAAACAACGCCTAAAAGCCGCTGAGGTAATCCGTTCGCTTCTTCACCCCGACTGCTATGTTGTTGCGGTCGAG
CATGATCTGTCCGTCCTTGACTACCTCTCTGATTTCATCTGTTGTCTCTACGGAAAACCATCCGTATATGGAGTC
GTCACCATGCCTTACTCTGTCCGCGAAGGAATCAACATCTTCCTTGATGGTTTCATCCCTACTGAAAACCTGCGA
TTCCGTGAAGAATCACTCTCATTCAAGATGGTCGAAACTGCGGAGGAGATTATCGTGGACAAGACGAGGCACTAT
TCATATCCATCCATGACCAAAACCCTCGGGGGCTTCAAACTCACAGTCGAAAGTGGTGGCTTCACTGATTCTGAA
ATAATCGTCATGCTCGGCGAAAATGGGACTGGCAAAACGACTTTCGTGCGGCTCCTTGCGGGCGACGTTCCTGAT
GATGAAACAGACAAACAGACATTTTCAGTATCATTGAAACCTCAGACAATATCGCCAAAGTTCGACGGAACTGTT
CGCCAACTTCTAATAAAACAAATCAAAGCTGCTTTCATGCACCCGCAGTTCCAAACTGATGTCCTCAAGCCTATG
AGTCTTGACAACGTTATGGATCAAGAAGTTAAAACTCTCTCGGGAGGAGAGTTGCAGCGTGTGGCTATCGTCCTC
GCACTCGGGAAACCCAATGCAATCTACCTGCTTGATGAACCATCGAGTTTCCTGGACTCCGAACAACGTATCATT
GCCAGTAAGGTTATCAAGCGATTTATCCTTCACTCCAAGAAAACTGCATTCGTTATCGAGCACGATTTTATCATG
GCCACGTATCTTGCTGATCGTGTGATCGTCTTCCAAGGTCAACCAGCCGTAGCTGCTACTGCCGCACCGCCCCAG
TCCCTGCTTTCGGGAATGAATAAGTTCCTTGCATCCTTAGAGATCACATTCCGTCGTGATCCGACAAATTTCCGC
CCTCGTGTAAACAAGCTTCACAGTATCAAGGACAGAGAGCAAAAAGCTGCTGGAAACTATTTCTTCCTCGAAGAT
TAA
Transcript >Agabi119p4|699750
ATGGCGGACAAGATAACCCGTATTGCTATCGTAGATGCAAATCGTTGCAAGCCGAAACGATGTGCACAAGAATGT
AAAAAGTCATGTCCAGTGGTGAAGATGGGAAAATTATGTATTGAGGTCAAGCCCTCGGACAAAATCGCATTTATC
TCAGAGTTTTTGTGTATCGGGTGTGGTATCTGCGTCAAAAAATGCCCATTCGAAGCCATCACAATCATCAATTTA
CCTACCAACTTGGAGTCAGCTGTTACGCACCGCTACACCGCGAACTCTTTCAAGCTACATCGATTGCCTACCCCT
CGTCCGGGTCAGGTTCTTGGTCTCGTTGGGACGAACGGAATCGGAAAGAGCACTGCCTTGAAGATCTTGGCTGGA
AAGCTCAAACCCAACCTAGGACGTTATGATGACCCACCCGATTGGGAGGAAATTTTGAAATATTTCCGAGGATCC
GAACTCCAGAACTACTTTACAAAGGTGCTTGAAGATAACTTGAAAGCGCTTATCAAACCGCAATATGTCGACCAT
ATTCCCAGAGCAATTAAGGGAAAGCAGACCGTTGATCAAATGCTTACTTCGAAAACGGAACTAGACAATAAGCAG
AGAATGTGTGATGAGCTTGAGCTCAACAAAGTTCTCGAACGAGAAGTCCCACAGTTGTCCGGTGGAGAGTTGCAA
AGATTTGCGATTGCCATGACTTGTGTCCAACAAGCCGATGTTTACATGTTTGATGAACCCTCAAGTTATCTTGAT
ATCAAACAACGCCTAAAAGCCGCTGAGGTAATCCGTTCGCTTCTTCACCCCGACTGCTATGTTGTTGCGGTCGAG
CATGATCTGTCCGTCCTTGACTACCTCTCTGATTTCATCTGTTGTCTCTACGGAAAACCATCCGTATATGGAGTC
GTCACCATGCCTTACTCTGTCCGCGAAGGAATCAACATCTTCCTTGATGGTTTCATCCCTACTGAAAACCTGCGA
TTCCGTGAAGAATCACTCTCATTCAAGATGGTCGAAACTGCGGAGGAGATTATCGTGGACAAGACGAGGCACTAT
TCATATCCATCCATGACCAAAACCCTCGGGGGCTTCAAACTCACAGTCGAAAGTGGTGGCTTCACTGATTCTGAA
ATAATCGTCATGCTCGGCGAAAATGGGACTGGCAAAACGACTTTCGTGCGGCTCCTTGCGGGCGACGTTCCTGAT
GATGAAACAGACAAACAGACATTTTCAGTATCATTGAAACCTCAGACAATATCGCCAAAGTTCGACGGAACTGTT
CGCCAACTTCTAATAAAACAAATCAAAGCTGCTTTCATGCACCCGCAGTTCCAAACTGATGTCCTCAAGCCTATG
AGTCTTGACAACGTTATGGATCAAGAAGTTAAAACTCTCTCGGGAGGAGAGTTGCAGCGTGTGGCTATCGTCCTC
GCACTCGGGAAACCCAATGCAATCTACCTGCTTGATGAACCATCGAGTTTCCTGGACTCCGAACAACGTATCATT
GCCAGTAAGGTTATCAAGCGATTTATCCTTCACTCCAAGAAAACTGCATTCGTTATCGAGCACGATTTTATCATG
GCCACGTATCTTGCTGATCGTGTGATCGTCTTCCAAGGTCAACCAGCCGTAGCTGCTACTGCCGCACCGCCCCAG
TCCCTGCTTTCGGGAATGAATAAGTTCCTTGCATCCTTAGAGATCACATTCCGTCGTGATCCGACAAATTTCCGC
CCTCGTGTAAACAAGCTTCACAGTATCAAGGACAGAGAGCAAAAAGCTGCTGGAAACTATTTCTTCCTCGAAGAT
TAA
Gene >Agabi119p4|699750
ATGGCGGACAAGATAACCCGTATTGCTATCGTAGATGCAAATCGTTGCAAGCCGAAACGATGTGCACAAGAATGT
AAAAAGGTGGGAAGTTCGCCCTTTGCCATGATCAGCCGTCGATAACAATTCAACCCAGTCATGTCCAGTGGTGAA
GATGGGTACGCCATAATCTGATAGATTTCGGGCTCGATTAATCGATTTGAAGGAAAATTATGTATTGAGGTCAAG
CCCTCGGACAAAATCGCATTTATCTCAGAGTTTTTGTGTATCGGGTGTGGTATCTGCGTCAAAAAGTACGTCTCA
ACGGGCATTATGAATAATCTCTAGCTAACCTCTGCTAGATGCCCATTCGAAGCCATCACAATCATCAATTTACCT
ACCAACTTGGAGTCAGCTGTTACGCACCGCTACACCGCGAACTCTTTCAAGCTACATCGATTGCCTACCCCTCGT
CCGGGTCAGGTTCTTGGTCTCGTTGGGACGAACGGAATCGGAAAGAGCACTGCCTTGAAGATCTTGGCTGGAAAG
CTCAAACCCAACCTAGGACGTTATGATGTGCGTTCAGTCATTGTCCGCGGCCAACGCCAACTCGCTTATTATCTC
ATCCTTCGTAGGACCCACCCGATTGGGAGGAAATTTTGAAATATTTCCGAGGATCCGAACTCCAGAACTACTTTA
CAAAGGTGCTTGAAGATAACTTGAAAGCGCTTATCAAACCGCAATATGTCGACCATATTCCCAGAGCAATTAAGG
GAAAGCAGACCGTTGATCAAATGCTTACTTCGAAAACGGAACTAGACAATAAGCAGAGAATGTGTGATGAGCTTG
AGCTCAACAAAGTTCTCGAACGAGAAGTCCCACAGTTGTCCGGTGGAGAGTTGCAAAGATTTGCGATTGCCATGA
CTTGTGTCCAACAAGCCGATGTGTAAGTGTGGCGCATTCAAAAGTCTGATATTTCTGATTATGTTGGCCTAGTTA
CATGTTTGATGAACCCTCAAGTTATCTTGATATCAAACAACGCCTAAAAGCCGCTGAGGTAATCCGTTCGCTTCT
TCACCCCGACTGCTATGTTGTTGCGGTCGAGCATGATCTGTCCGTCCTTGACTACCTCTCTGATTTCATCTGTTG
TCTCTACGGAAAACCATCCGTATATGGAGTCGTCACCATGCCTTACTCTGTCCGCGAAGGAATCAACATCTTCCT
TGATGGTTTCATCCCTACTGAAAACCTGCGATTCCGTGAAGAATCACTCTCATTCAAGATGGTCGAAACTGCGGA
GGAGATTATCGTGGACAAGACGAGGCACTATTCATATCCATCCATGACCAAAACCCTCGGGGGCTTCAAACTCAC
AGTCGAAAGTGGTGGCTTCACTGATTCTGAAATAATCGTCATGCTCGGCGAAAATGGGACTGGCAAAACGACTTT
CGTGCGGCTCCTTGCGGGCGACGTTCCTGATGATGAAACAGACAAACAGACATTTTCAGTATCATTGAAACCTCA
GACAATATCGCCAAAGTTCGACGGAACTGTTCGCCAACTTCTAATAAAACAAATCAAAGCTGCTTTCATGCACCC
GCAGTTCCAAACTGATGTCCTCAAGCCTATGAGTCTTGACAACGTTATGGATCAAGAAGTTAAAACTCTCTCGGG
AGGAGAGTTGCAGCGTGTGGCTATCGTCCTCGCACTCGGTGAGTTGATATCATCCGTGACCACCCAGATAGCGGG
GATGGATGTTGATATTCTTCGGTCATCTAGGGAAACCCAATGCAATCTACCTGCTTGATGAACCATCGAGGTCGG
TATTTTTATTTATAACTCAAAAGACCTAACGATGTTAAAAATCTCATAGTTTCCTGGACTCCGAACAACGTATCA
TTGCCAGTAAGGTTATCAAGCGGTGCGTGATTTCTCTTATAGATATATATCATCAGCCTGAGGTGCTCCTCCCTT
CTTTTTCTTCTTCCCTCCTCACTGTCACTGGCCGACGCTAGATTTATCCTTCACTCCAAGAAAACTGCATTCGTT
ATCGAGCACGATTTTATCATGGCCACGTATCTTGCTGATCGTGTGATCGTCTTCCAAGGTCAACCAGCCGTAGCT
GCTACTGCCGCACCGTATGACTCATCCCTCACTAAAATTATGATCATATGCTGACATTTCCTTGAATAGGCCCCA
GTCCCTGCTTTCGGGAATGAATAAGTTCCTTGCATCCTTAGAGATCACATTCCGTCGTGATCCGACAAATTTCCG
CCCTCGTGTAAACAAGCTTCACAGTATCAAGGACAGAGAGCAAAAAGGTAGGTTCTTTTGTTGAAACGGACAGAT
GACTGGATGTGGATTGATATTTATACAACATTCTAGCTGCTGGAAACTATTTCTTCCTCGAAGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail