Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|698750
Gene name
Locationscaffold_08:769316..770600
Strand+
Gene length (bp)1284
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 8.2E-20 49 171
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.8E-18 51 420
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.4E-08 50 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 44 170 1.0E-15
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 48 427 3.0E-15
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 44 170 3.0E-12
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 44 170 2.0E-11
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 31 170 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 44 170 1.0E-15
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 48 427 3.0E-15
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 44 170 3.0E-12
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 44 170 2.0E-11
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 31 170 3.0E-11
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 48 171 7.0E-10
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 44 178 9.0E-10
sp|G5EDL5|CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans GN=ceeh-2 PE=1 SV=1 26 170 2.0E-08
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 49 215 4.0E-08
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 48 177 5.0E-08
sp|Q1JU72|DEHA_BURSP Fluoroacetate dehalogenase OS=Burkholderia sp. GN=fac-dex PE=1 SV=1 40 168 1.0E-06
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 44 169 3.0E-06
sp|Q73Y99|DHMA_MYCPA Haloalkane dehalogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dhmA PE=3 SV=1 20 168 5.0E-06
sp|Q93K00|DHMA_MYCAV Haloalkane dehalogenase OS=Mycobacterium avium GN=dhmA PE=1 SV=1 20 168 5.0E-06
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 44 170 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|698750
MLWPELPPEVISRQILVSDLDVHILECLPLGTHHHCLGSNTVPGPRKAPLVILLHGFPELAYSWRKVFVPLAKAG
YHVIAPDQRGYGFTVPVASSSDPSTGSGYKRLAYDDDVRPYHLLNLAADMVHLMHALEYDRAYAVVGHDFGSSVA
AWTALVRPDMVGRLVLMSAPFGGPPKPRDAGSARRKEESKAYLVDSLLKKLEVPRKHYTVYYSTPEANADMSYPP
EGLTDFLRAYYHVKSADWEGNETPLPTRLPLRLETTGSQPPSGAEITKAVAEAMAMLPPYYVMPADLTMPEAVRQ
YFPASEQPCTCTWLTNEELQVYTSVYGQTGFQGGLNRYRCMTDETWNAEPGVRALCGKKIEVPVRFIAGATDWGT
WQYPGIAEAMRSESVVKGGIGDKDFVVVEGAGHWVQQEKPEETVHALLQFFE*
Coding >Agabi119p4|698750
ATGCTTTGGCCCGAACTTCCGCCTGAAGTCATCTCGCGGCAGATCCTCGTAAGCGATTTGGATGTGCATATCCTC
GAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACAGTTCCAGGTCCACGGAAAGCGCCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTGGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGATCTGGATACAAGCGCCTCGCATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATATG
GTACACCTAATGCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGGTTGGGCGACTTGTGTTGATGAGCGCGCCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGCGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACTACGGGTTCACAGCCTCCTTCAGGAGCGGAGATAACGAAAGCAGTT
GCGGAGGCGATGGCGATGCTACCGCCTTACTACGTCATGCCTGCCGATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTGAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGGGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGAACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTC
TTTGAGTAG
Transcript >Agabi119p4|698750
ATGCTTTGGCCCGAACTTCCGCCTGAAGTCATCTCGCGGCAGATCCTCGTAAGCGATTTGGATGTGCATATCCTC
GAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACAGTTCCAGGTCCACGGAAAGCGCCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTGGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGATCTGGATACAAGCGCCTCGCATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATATG
GTACACCTAATGCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGGTTGGGCGACTTGTGTTGATGAGCGCGCCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGCGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACTACGGGTTCACAGCCTCCTTCAGGAGCGGAGATAACGAAAGCAGTT
GCGGAGGCGATGGCGATGCTACCGCCTTACTACGTCATGCCTGCCGATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTGAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGGGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGAACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTC
TTTGAGTAG
Gene >Agabi119p4|698750
ATGCTTTGGCCCGAACTTCCGCCTGAAGTCATCTCGCGGCAGATCCTCGTAAGCGATTTGGATGTGCATATCCTC
GAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACAGTTCCAGGTCCACGGAAAGCGCCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTGGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGATCTGGATACAAGCGCCTCGCATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATATG
GTACACCTAATGCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGGTTGGGCGACTTGTGTTGATGAGCGCGCCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGCGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACTACGGGTTCACAGCCTCCTTCAGGAGCGGAGATAACGAAAGCAGTT
GCGGAGGCGATGGCGATGCTACCGCCTTACTACGTCATGCCTGCCGATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTGAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGGGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGAACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTC
TTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail