Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|698500
Gene name
Locationscaffold_08:716424..718119
Strand-
Gene length (bp)1695
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.5E-28 83 219
PF08031 BBE Berberine and berberine like 3.9E-06 440 469

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 58 468 1.0E-21
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 91 292 5.0E-20
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 75 468 7.0E-19
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 83 468 2.0E-18
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 83 468 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 58 468 1.0E-21
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 91 292 5.0E-20
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 75 468 7.0E-19
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 83 468 2.0E-18
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 83 468 7.0E-18
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 83 468 1.0E-16
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 83 468 5.0E-16
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 77 468 7.0E-16
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 83 446 8.0E-15
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 85 253 2.0E-14
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 83 468 4.0E-14
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 83 254 5.0E-14
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 63 259 7.0E-13
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 80 253 7.0E-13
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 85 256 3.0E-12
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 94 236 1.0E-10
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 85 253 2.0E-10
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 85 253 4.0E-10
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 83 254 6.0E-10
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 83 468 2.0E-09
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 91 301 2.0E-08
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 79 253 1.0E-07
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 83 258 4.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 40 253 6.0E-07
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 79 254 9.0E-07
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 79 254 9.0E-07
sp|Q0PCD7|AKNOX_STRGJ Aclacinomycin-N/aclacinomycin-A oxidase OS=Streptomyces galilaeus GN=aknOx PE=1 SV=1 83 249 1.0E-06
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 80 282 2.0E-06
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 81 256 5.0E-06
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 83 274 5.0E-06
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 72 253 7.0E-06
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 83 253 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|698500
MTSHCIFGNVLASLTGTLISLVSRHYSQCKSTTQSAKKGAISEEHAKEIRALLSSDDQLLLPGTAAYKTAVYTGN
LLYINKAPGAVVVPSTAEEIASTVSFARNHNILLTIKNGGNSFAGYCLNLGGIVIDLCRFKKIHIDDKANVVTIQ
AGCIWSEVYNTLSKQDPSYIVVGGRCPNVGVSGYTLGGGFSPFTRSHGLGIDNVIEMTVVTPAGQILTLNDKVTD
AHQRDLYWALRGGGGGNFGFLVEFKTQLHRLSDANAKVACGPLSWDLSDKDARGRDQLLGEMTTIFDGNLKKCME
VLDPLLKFQPTNAIAEMQWHEWLVAEQGFDSLSPVYHHHTSFIFGQGAITPTVTKAITSLMEESHELLGRKGKSH
FLWDMAGYKSTTVAPDATPYYWREGIYIIAFKLQWEDPAMKASVLAFTEKIKNTLQPHALEHRAAYLNYIDPTVD
DWAYAYYGKNYAWLQEIKQH*
Coding >Agabi119p4|698500
ATGACGAGCCACTGTATCTTCGGCAACGTACTCGCATCCCTCACTGGTACTCTCATAAGCTTAGTATCGCGACAT
TACTCGCAATGTAAATCAACAACTCAATCTGCGAAGAAGGGGGCAATCTCTGAGGAACACGCAAAGGAGATTCGT
GCCCTCTTATCGTCCGACGATCAACTCCTCCTCCCGGGTACTGCTGCCTACAAAACCGCTGTCTACACCGGGAAC
CTATTATACATCAACAAAGCACCAGGAGCAGTTGTAGTCCCCTCTACGGCGGAGGAAATCGCATCTACCGTCTCT
TTTGCTCGCAATCACAATATCCTCCTCACCATCAAGAACGGAGGGAATTCCTTCGCTGGCTATTGCCTCAATCTC
GGCGGAATCGTTATCGATTTGTGTCGGTTCAAGAAAATACACATCGATGACAAGGCGAACGTAGTAACTATCCAA
GCTGGGTGTATCTGGAGCGAGGTATACAACACTCTTAGCAAGCAAGATCCCTCCTATATCGTCGTTGGTGGCCGA
TGCCCTAACGTTGGCGTTTCTGGTTATACCCTCGGTGGTGGTTTTAGCCCCTTCACTCGTAGCCATGGTCTTGGT
ATCGACAACGTCATTGAGATGACTGTCGTCACCCCGGCCGGACAGATTCTCACTCTCAATGACAAAGTAACTGAC
GCTCATCAACGGGACCTATATTGGGCTTTGCGTGGAGGCGGAGGTGGTAATTTCGGTTTCTTGGTTGAATTCAAA
ACACAGCTTCACCGACTGAGTGATGCGAATGCTAAAGTCGCTTGTGGCCCTTTGAGCTGGGATTTATCGGATAAG
GATGCGAGAGGTCGGGACCAACTCTTGGGAGAGATGACGACGATCTTTGATGGGAATTTAAAGAAATGTATGGAG
GTTCTGGATCCCCTTCTCAAATTCCAGCCGACCAACGCCATCGCAGAGATGCAATGGCACGAATGGCTGGTCGCC
GAGCAAGGTTTTGACAGTCTGTCTCCCGTCTATCACCATCACACTTCCTTCATCTTCGGCCAAGGTGCTATCACA
CCTACAGTCACCAAAGCCATTACCTCGCTCATGGAAGAATCCCATGAGCTTCTGGGTAGGAAAGGAAAGTCTCAT
TTCTTGTGGGACATGGCAGGTTACAAGTCTACAACTGTTGCGCCAGATGCCACTCCTTATTATTGGCGCGAAGGA
ATCTATATCATTGCCTTCAAGTTACAGTGGGAAGATCCAGCGATGAAGGCGAGTGTGCTCGCCTTTACGGAGAAA
ATCAAGAATACTCTCCAACCACACGCTCTCGAACATAGAGCTGCGTATTTGAACTACATCGACCCGACGGTCGAC
GACTGGGCTTACGCGTATTATGGCAAGAACTACGCTTGGTTGCAGGAAATTAAGCAACACTGA
Transcript >Agabi119p4|698500
ATGACGAGCCACTGTATCTTCGGCAACGTACTCGCATCCCTCACTGGTACTCTCATAAGCTTAGTATCGCGACAT
TACTCGCAATGTAAATCAACAACTCAATCTGCGAAGAAGGGGGCAATCTCTGAGGAACACGCAAAGGAGATTCGT
GCCCTCTTATCGTCCGACGATCAACTCCTCCTCCCGGGTACTGCTGCCTACAAAACCGCTGTCTACACCGGGAAC
CTATTATACATCAACAAAGCACCAGGAGCAGTTGTAGTCCCCTCTACGGCGGAGGAAATCGCATCTACCGTCTCT
TTTGCTCGCAATCACAATATCCTCCTCACCATCAAGAACGGAGGGAATTCCTTCGCTGGCTATTGCCTCAATCTC
GGCGGAATCGTTATCGATTTGTGTCGGTTCAAGAAAATACACATCGATGACAAGGCGAACGTAGTAACTATCCAA
GCTGGGTGTATCTGGAGCGAGGTATACAACACTCTTAGCAAGCAAGATCCCTCCTATATCGTCGTTGGTGGCCGA
TGCCCTAACGTTGGCGTTTCTGGTTATACCCTCGGTGGTGGTTTTAGCCCCTTCACTCGTAGCCATGGTCTTGGT
ATCGACAACGTCATTGAGATGACTGTCGTCACCCCGGCCGGACAGATTCTCACTCTCAATGACAAAGTAACTGAC
GCTCATCAACGGGACCTATATTGGGCTTTGCGTGGAGGCGGAGGTGGTAATTTCGGTTTCTTGGTTGAATTCAAA
ACACAGCTTCACCGACTGAGTGATGCGAATGCTAAAGTCGCTTGTGGCCCTTTGAGCTGGGATTTATCGGATAAG
GATGCGAGAGGTCGGGACCAACTCTTGGGAGAGATGACGACGATCTTTGATGGGAATTTAAAGAAATGTATGGAG
GTTCTGGATCCCCTTCTCAAATTCCAGCCGACCAACGCCATCGCAGAGATGCAATGGCACGAATGGCTGGTCGCC
GAGCAAGGTTTTGACAGTCTGTCTCCCGTCTATCACCATCACACTTCCTTCATCTTCGGCCAAGGTGCTATCACA
CCTACAGTCACCAAAGCCATTACCTCGCTCATGGAAGAATCCCATGAGCTTCTGGGTAGGAAAGGAAAGTCTCAT
TTCTTGTGGGACATGGCAGGTTACAAGTCTACAACTGTTGCGCCAGATGCCACTCCTTATTATTGGCGCGAAGGA
ATCTATATCATTGCCTTCAAGTTACAGTGGGAAGATCCAGCGATGAAGGCGAGTGTGCTCGCCTTTACGGAGAAA
ATCAAGAATACTCTCCAACCACACGCTCTCGAACATAGAGCTGCGTATTTGAACTACATCGACCCGACGGTCGAC
GACTGGGCTTACGCGTATTATGGCAAGAACTACGCTTGGTTGCAGGAAATTAAGCAACACTGA
Gene >Agabi119p4|698500
ATGACGAGCCACTGTATCTTCGGCAACGTACTCGCATCCCTCACTGGTACTCTCATAAGGTAAATACAACAACGA
CTCATATACGCGATTCCTGACAATTTTTAGCTTGTAACATGGCTTTTTACTCTGCGAATCAGAATATTCCTAGCA
TCGTCTTGCCTTCGGATCCAGAGTATCGCGACATTACTCGCAATGTAAGTATCTATTTCCCCCACCTTCACAGGC
TTGTTTGCTTAACAAACTTCAAGGTAAATCAACAACTCAAGTAGCGTAATGAAGTGGTCATCGCCGCTAAGGCGA
AAGGCCAGTCTGCGAAGAAGGGGGCAATCTCTGAGGAACACGCAAAGGAGATTCGTGCCCTCTTATCGTCCGACG
ATCAACTCCTCCTCCCGGGTACTGCTGCCTACAAAACCGCTGTCTACACCGGGAACCTATTATACATCAACAAAG
CACCAGGAGCAGTTGTAGTCCCCTCTACGGCGGAGGAAATCGCATCTACCGTCTCTTTTGCTCGCAATCACAATA
TCCTCCTCACCATCAAGAACGGAGGGAATTCCTTCGCTGGCTATTGCCTCAATCTCGGCGGAATCGTTATCGATT
TGTGTCGGTTCAAGAAAATACACATCGATGACAAGGCGAACGTAGTAACTATCCAAGCTGGGTGTATCTGGAGCG
AGGTATACAACACTCTTAGCAAGCAAGATCCCTCCTATATCGTCGTTGGTGGCCGATGCCCTAACGTTGGCGTTT
CTGGTTATACCCTCGGTGGTGGTTTTAGCCCCTTCACTCGTAGCCATGGTCTTGGTATCGACAACGTCATTGAGA
TGACTGTCGTCACCCCGGCCGGACAGATTCTCACTCTCAATGACAAAGTAACTGACGCTCATCAACGGGACCTAT
ATTGGGCTTTGCGTGGAGGCGGAGGTGGTAATTTCGGTTTCTTGGTTGAATTCAAAACACAGCTTCACCGACTGA
GTGATGCGAATGCTAAAGTCGCTTGTGGCCCTTTGAGCTGGGATTTATCGGATAAGGATGCGAGAGGTCGGTTTG
AGGCCGCCATGGACGTGTTTAACACACGTGAATGGCCTAAGGAACTTACTATCGATGCCATATGGCGATAGGGAC
CAACTCTTGGGAGAGATGACGACGATCTTTGATGGGAATTTAAAGAAATGTATGGAGGTTCTGGATCCCCTTCTC
AAATTCCAGCCGACCAACGCCATCGCAGAGATGCAATGGCACGAATGGCTGGTCGCCGAGCAAGGTTTTGACAGT
CTGTCTCCCGTCTATCACCATCACACTTCCTTCATCTTCGGCCAAGGTGCTATCACACCTACAGTCACCAAAGCC
ATTACCTCGCTCATGGAAGAATCCCATGAGCTTCTGGGTAGGAAAGGAAAGTCTCATTTCTTGTGGGACATGGCA
GGTTACAAGTCTACAACTGTTGCGCCAGATGCCACTCCTTATTATTGGCGCGAAGGAATCTATATCATTGCCTTC
AAGTTACAGTGGGAAGATCCAGCGATGAAGGCGAGTGTGCTCGCCTTTACGGAGAAAATCAAGAATACTCTCCAA
CCACACGCTCTCGAACATAGAGCTGCGTATTTGAACTACATCGACCCGACGGTCGACGACTGGGCTTACGCGTAT
TATGGCAAGAACTACGCTTGGTTGCAGGAAATTAAGCAACACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail