Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|697350
Gene name
Locationscaffold_08:594588..596306
Strand-
Gene length (bp)1718
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.8E-41 99 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 13 355 5.0E-76
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 20 350 5.0E-75
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 14 349 2.0E-66
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 17 305 2.0E-46
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 29 305 2.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 13 355 5.0E-76
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 20 350 5.0E-75
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 14 349 2.0E-66
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 17 305 2.0E-46
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 29 305 2.0E-44
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 75 326 8.0E-25
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 134 290 4.0E-23
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 58 286 4.0E-21
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 123 286 1.0E-19
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 121 287 7.0E-19
sp|Q5AK54|CRH12_CANAL Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH12 PE=1 SV=1 121 306 4.0E-13
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 117 271 1.0E-12
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 117 270 2.0E-12
sp|Q8LF99|XTH6_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2 119 314 2.0E-11
sp|Q9ZSU4|XTH14_ARATH Xyloglucan endotransglucosylase/hydrolase protein 14 OS=Arabidopsis thaliana GN=XTH14 PE=1 SV=1 104 293 4.0E-11
sp|P27051|GUB_BACLI Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE=1 SV=1 85 270 6.0E-11
sp|Q38911|XTH15_ARATH Xyloglucan endotransglucosylase/hydrolase protein 15 OS=Arabidopsis thaliana GN=XTH15 PE=1 SV=1 101 317 7.0E-11
sp|P04957|GUB_BACSU Beta-glucanase OS=Bacillus subtilis (strain 168) GN=bglS PE=1 SV=2 85 275 8.0E-11
sp|P07980|GUB_BACAM Beta-glucanase OS=Bacillus amyloliquefaciens GN=bglA PE=3 SV=1 85 270 1.0E-10
sp|Q9FKL9|XTH12_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 12 OS=Arabidopsis thaliana GN=XTH12 PE=2 SV=1 104 293 2.0E-10
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 104 270 5.0E-10
sp|Q9FKL8|XTH13_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 13 OS=Arabidopsis thaliana GN=XTH13 PE=3 SV=1 104 293 6.0E-10
sp|P35694|XTH2_SOYBN Xyloglucan endotransglucosylase/hydrolase 2 OS=Glycine max PE=2 SV=1 104 304 7.0E-10
sp|Q8LG58|XTH16_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 16 OS=Arabidopsis thaliana GN=XTH16 PE=2 SV=2 100 314 1.0E-09
sp|P45797|GUB_PAEPO Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1 85 264 2.0E-09
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 131 270 8.0E-09
sp|Q9ZVK1|XTH10_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 10 OS=Arabidopsis thaliana GN=XTH10 PE=2 SV=1 112 264 1.0E-08
sp|Q8LER3|XTH7_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana GN=XTH7 PE=2 SV=2 114 317 2.0E-08
sp|P37073|GUB_BREBE Beta-glucanase OS=Brevibacillus brevis GN=bglBB PE=1 SV=1 116 266 3.0E-08
sp|Q39099|XTH4_ARATH Xyloglucan endotransglucosylase/hydrolase protein 4 OS=Arabidopsis thaliana GN=XTH4 PE=1 SV=1 118 272 5.0E-08
sp|Q38907|XTH25_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2 100 293 1.0E-07
sp|Q38910|XTH23_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1 101 293 1.0E-07
sp|Q38857|XTH22_ARATH Xyloglucan endotransglucosylase/hydrolase protein 22 OS=Arabidopsis thaliana GN=XTH22 PE=1 SV=1 101 293 1.0E-07
sp|Q6YDN9|XTH_BRAOB Xyloglucan endotransglucosylase/hydrolase OS=Brassica oleracea var. botrytis GN=XET16A PE=1 SV=1 118 272 3.0E-07
sp|Q8L9A9|XTH8_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 8 OS=Arabidopsis thaliana GN=XTH8 PE=2 SV=2 114 272 5.0E-07
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 113 270 8.0E-07
sp|Q9SV60|XTH2_ARATH Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana GN=XTH2 PE=2 SV=1 116 264 2.0E-06
sp|Q9XIW1|XTH5_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 5 OS=Arabidopsis thaliana GN=XTH5 PE=2 SV=1 118 272 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|697350
MHRHTGVLIIPVLLTWLAGIATAASGTTCNATTLCPASAPCCSEFGFCGDDSFCLGGCNPFASHSVDSCRPSPIC
EDAMFTFPDNSRILSNADYFEGNASEYDWVVNKGNIMNTNSSGGELVLTLTEENGGTRLSSTRYVYYGTISAKLK
TGKWGGVVTAFITMSDIKDEIDWEFPGTHTTQGQTNYFWQGVIPTDKTNGKTTTEPLSDTFSNYHTYTIDWQQDQ
LKFLIDGKNQQTVKKSDTIDSNGVAHYPSTPSRIQLSLWPAGTDDQAPGTVQWAGGMIDWNDPDYKAAGHFYATV
QSVEVKCAPVLKPSPNDTSYIYSNSSDHSSPTITLSNHSTLLNSAPVDGVSGMHGMMVGLIALFLAFVHLF*
Coding >Agabi119p4|697350
ATGCACCGACACACAGGCGTTTTGATAATTCCTGTTCTCCTCACATGGCTGGCCGGAATTGCAACCGCAGCCTCA
GGTACCACCTGCAACGCCACTACACTATGCCCTGCTTCTGCGCCCTGTTGCAGTGAATTTGGATTTTGTGGAGAC
GACAGTTTTTGTTTGGGTGGCTGTAACCCTTTTGCTTCTCACTCCGTCGACTCGTGCCGCCCTAGCCCGATCTGT
GAGGATGCCATGTTTACTTTCCCTGACAACTCTCGTATCCTTTCCAATGCTGACTACTTTGAAGGAAACGCCTCA
GAGTACGATTGGGTTGTCAATAAAGGAAATATCATGAACACCAATTCGAGTGGAGGCGAGCTTGTCCTGACGCTC
ACAGAGGAGAATGGAGGAACAAGGCTTTCTTCCACCAGATATGTTTATTATGGCACCATAAGTGCTAAACTGAAG
ACCGGTAAATGGGGAGGCGTAGTCACGGCGTTTATCACTATGAGTGATATCAAAGACGAAATCGATTGGGAGTTT
CCTGGTACCCATACTACTCAAGGTCAAACGAACTATTTCTGGCAGGGTGTTATTCCTACGGACAAGACCAATGGG
AAAACGACTACGGAACCTCTTTCGGACACATTCAGCAATTACCATACATACACCATCGATTGGCAACAGGACCAA
TTGAAGTTTTTGATTGATGGGAAGAATCAACAGACCGTCAAGAAGTCCGACACTATTGATTCTAATGGTGTTGCT
CACTACCCGAGTACTCCGTCCCGCATTCAGCTTTCCTTGTGGCCTGCCGGCACCGACGACCAAGCACCTGGAACC
GTTCAGTGGGCCGGAGGTATGATCGATTGGAACGACCCCGACTATAAGGCTGCAGGCCATTTCTATGCCACTGTT
CAATCTGTTGAAGTTAAATGTGCCCCCGTCCTAAAACCCAGCCCCAATGATACTTCATACATATATTCCAATTCT
TCCGATCATTCTTCACCTACGATTACCCTCAGCAATCATTCAACTTTGTTGAATTCTGCTCCTGTTGATGGTGTG
TCTGGTATGCATGGCATGATGGTTGGATTGATTGCTTTGTTCCTCGCATTTGTACACTTGTTTTGA
Transcript >Agabi119p4|697350
ATGCACCGACACACAGGCGTTTTGATAATTCCTGTTCTCCTCACATGGCTGGCCGGAATTGCAACCGCAGCCTCA
GGTACCACCTGCAACGCCACTACACTATGCCCTGCTTCTGCGCCCTGTTGCAGTGAATTTGGATTTTGTGGAGAC
GACAGTTTTTGTTTGGGTGGCTGTAACCCTTTTGCTTCTCACTCCGTCGACTCGTGCCGCCCTAGCCCGATCTGT
GAGGATGCCATGTTTACTTTCCCTGACAACTCTCGTATCCTTTCCAATGCTGACTACTTTGAAGGAAACGCCTCA
GAGTACGATTGGGTTGTCAATAAAGGAAATATCATGAACACCAATTCGAGTGGAGGCGAGCTTGTCCTGACGCTC
ACAGAGGAGAATGGAGGAACAAGGCTTTCTTCCACCAGATATGTTTATTATGGCACCATAAGTGCTAAACTGAAG
ACCGGTAAATGGGGAGGCGTAGTCACGGCGTTTATCACTATGAGTGATATCAAAGACGAAATCGATTGGGAGTTT
CCTGGTACCCATACTACTCAAGGTCAAACGAACTATTTCTGGCAGGGTGTTATTCCTACGGACAAGACCAATGGG
AAAACGACTACGGAACCTCTTTCGGACACATTCAGCAATTACCATACATACACCATCGATTGGCAACAGGACCAA
TTGAAGTTTTTGATTGATGGGAAGAATCAACAGACCGTCAAGAAGTCCGACACTATTGATTCTAATGGTGTTGCT
CACTACCCGAGTACTCCGTCCCGCATTCAGCTTTCCTTGTGGCCTGCCGGCACCGACGACCAAGCACCTGGAACC
GTTCAGTGGGCCGGAGGTATGATCGATTGGAACGACCCCGACTATAAGGCTGCAGGCCATTTCTATGCCACTGTT
CAATCTGTTGAAGTTAAATGTGCCCCCGTCCTAAAACCCAGCCCCAATGATACTTCATACATATATTCCAATTCT
TCCGATCATTCTTCACCTACGATTACCCTCAGCAATCATTCAACTTTGTTGAATTCTGCTCCTGTTGATGGTGTG
TCTGGTATGCATGGCATGATGGTTGGATTGATTGCTTTGTTCCTCGCATTTGTACACTTGTTTTGA
Gene >Agabi119p4|697350
ATGCACCGACACACAGGCGTTTTGATAATTCCTGTTCTCCTCACATGGCTGGCCGGAATTGCAACCGCAGCCTCA
GGTACCACCTGGTTGGCACTTTTCCCGTTACTATTGCAGAAACCGAGGACTGAGGATGAATCTAGCAACGCCACT
ACACTATGCCCTGCTTCTGCGCCCTGTTGCAGTACGTCCAAATTCTGCAGTCGTGCTCTATTAATAAAATTTGAT
ATCGATCTCAAGGTGAATTTGGATTTTGTGGAGACGACAGTGTAAGCAACTTCGGAAGCCTAATCTCTTACGATA
TGTGGAGACTGATTGAGCCGCCCACTTGATTGACTATCAGTTTTGTTTGGGTGGCTGTAACCCTTTTGCTTCTCA
CTCCGTCGACTCGTGCCGCCCTAGCCCGATCTGTGAGGATGCCATGGTATGTACCTCAGTTCCCTGTCAAATAGC
TCTATCTGACAGCATTCTAGTTTACTTTCCCTGACAACTCTCGTATCCTTTCCAATGCTGACTACTTTGAAGGAA
ACGCCTCAGAGTACGGTAAGCGCTGTTTTTTTTTGCGTCTCGAGTCTGGGTTGGAATCTGATGTTTGGTTGGGGT
GGGATCTCATTAGATTGGGTTGTCAATAAAGGAAATATCATGAACACCAATTCGAGTGGAGGCGAGCTTGTCCTG
ACGCTCACAGAGGAGAATGGAGGAACAAGGCTTTCTTCCACCAGATATGTTTATTATGGCACCATAAGTGCTAAA
CGTACGTCAATCTCATTCCCCAGCTCTGTCAACATTTCCTGATGCCAATTAATCTGTAGTGAAGACCGGTAAATG
GGGAGGCGTAGTCACGGCGTTTATCACTATGAGTGATATCAAAGACGAAATCGATTGGGAGTTTCCTGGTACCCA
TACTACTCAAGGTCAAACGAACTATTTCTGGCAGGGTGTTATTCGTACGTTGTCTTGTTTTGTCGTCTCCCCAAA
AAAGGCGTAATAAGGGACACCCTATAGCTACGGACAAGACCAATGGGAAAACGACTACGGAACCTCTTTCGGACA
CATTCAGCAATTACCATACATACACCGTGAATACCTTACATCACCATTGAGGCCAGTCCGAGCGACTAACTTGCT
TTATAAAGATCGATTGGCAACAGGACCAATTGAAGTTTTTGATTGATGGGAAGAATCAACAGACCGTCAAGAAGT
CCGACACTATTGATTCTAATGGTGTTGCTCACTACCCGAGTACTCCGTCCCGCATTCAGCTTTCGTGAGCCATTA
ACTTTTGATATACCCTGACTAGACTGTTGAACACTATTGTATCTTGCAGCTTGTGGCCTGCCGGCACCGACGACC
AAGCACCTGGAACCGTTCAGTGGGCCGGAGGTATGATCGATTGGAACGACCCCGACTATAAGGCTGCAGGTACGT
CAACAGTATAATACGGTTCAGCTCCGTTCTTTTACTCACATGGACAAACTCGTTCAGGCCATTTCTATGCCACTG
TTCAATCTGTTGAAGTTAAATGTGCCCCCGTCCTAAAACCCAGCCCCAATGATACTTCATACATATATTCCAATT
CTTCCGATCATTCTTCACCTACGATTACCCTCAGCAATCATTCAACTTTGTTGAATTCTGCTCCTGTTGATGGTG
TGTCTGGTATGCATGGCATGATGGTTGGATTGATTGCTTTGTTCCTCGCATTTGTACACTTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail