© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|696450 |
| Gene name | |
| Location | scaffold_08:528240..532696 |
| Strand | + |
| Gene length (bp) | 4456 |
| Transcript length (bp) | 3921 |
| Coding sequence length (bp) | 3921 |
| Protein length (aa) | 1307 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00400 | WD40 | WD domain, G-beta repeat | 1.4E-03 | 984 | 1017 |
| PF00400 | WD40 | WD domain, G-beta repeat | 5.0E-07 | 1040 | 1065 |
| PF00400 | WD40 | WD domain, G-beta repeat | 1.9E-06 | 1074 | 1106 |
| PF00400 | WD40 | WD domain, G-beta repeat | 2.9E-05 | 1124 | 1154 |
| PF00400 | WD40 | WD domain, G-beta repeat | 6.8E-07 | 1160 | 1196 |
| PF00400 | WD40 | WD domain, G-beta repeat | 1.4E-07 | 1223 | 1260 |
| PF00400 | WD40 | WD domain, G-beta repeat | 1.6E-03 | 1269 | 1301 |
| PF12894 | ANAPC4_WD40 | Anaphase-promoting complex subunit 4 WD40 domain | 2.4E-05 | 1032 | 1087 |
| PF05729 | NACHT | NACHT domain | 8.5E-10 | 230 | 382 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 950 | 1305 | 2.0E-122 |
| sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 952 | 1304 | 1.0E-114 |
| sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 942 | 1302 | 2.0E-110 |
| sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 937 | 1303 | 2.0E-104 |
| sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 937 | 1303 | 2.0E-104 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 950 | 1305 | 2.0E-122 |
| sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 952 | 1304 | 1.0E-114 |
| sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 942 | 1302 | 2.0E-110 |
| sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 937 | 1303 | 2.0E-104 |
| sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 937 | 1303 | 2.0E-104 |
| sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 961 | 1301 | 4.0E-100 |
| sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 947 | 1303 | 1.0E-97 |
| sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 950 | 1305 | 3.0E-92 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 960 | 1304 | 5.0E-50 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 989 | 1304 | 5.0E-49 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 989 | 1304 | 4.0E-43 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 965 | 1304 | 9.0E-43 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 989 | 1304 | 1.0E-42 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 989 | 1300 | 5.0E-41 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 1039 | 1304 | 8.0E-40 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 980 | 1304 | 1.0E-36 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 989 | 1304 | 1.0E-36 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 989 | 1304 | 8.0E-35 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 989 | 1274 | 1.0E-34 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 989 | 1300 | 1.0E-34 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 1040 | 1301 | 2.0E-34 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 981 | 1304 | 7.0E-34 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 989 | 1197 | 3.0E-31 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 1034 | 1300 | 1.0E-29 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 972 | 1269 | 4.0E-29 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 1034 | 1300 | 4.0E-29 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 965 | 1198 | 5.0E-29 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 959 | 1303 | 5.0E-29 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 969 | 1301 | 1.0E-28 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 983 | 1302 | 3.0E-28 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 974 | 1300 | 1.0E-27 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 1034 | 1300 | 1.0E-27 |
| sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 989 | 1300 | 2.0E-27 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 1073 | 1304 | 3.0E-27 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 983 | 1267 | 4.0E-27 |
| sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 967 | 1202 | 4.0E-27 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 989 | 1301 | 4.0E-27 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 998 | 1300 | 5.0E-27 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 989 | 1301 | 6.0E-27 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 1032 | 1300 | 8.0E-27 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 1072 | 1300 | 2.0E-26 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 989 | 1262 | 2.0E-26 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 1034 | 1301 | 3.0E-26 |
| sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 1034 | 1300 | 5.0E-26 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 989 | 1277 | 7.0E-26 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 989 | 1288 | 8.0E-26 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 989 | 1288 | 8.0E-26 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 989 | 1288 | 8.0E-26 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 989 | 1288 | 9.0E-26 |
| sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 989 | 1198 | 1.0E-25 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 968 | 1288 | 1.0E-25 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 989 | 1300 | 2.0E-25 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 1034 | 1300 | 2.0E-25 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 989 | 1266 | 3.0E-25 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 989 | 1288 | 4.0E-25 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 989 | 1266 | 6.0E-25 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 989 | 1288 | 1.0E-24 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 1071 | 1304 | 2.0E-24 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 1049 | 1287 | 2.0E-24 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 1049 | 1302 | 2.0E-24 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 989 | 1300 | 2.0E-24 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 998 | 1294 | 2.0E-24 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 989 | 1259 | 3.0E-24 |
| sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 992 | 1260 | 3.0E-24 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 989 | 1266 | 4.0E-24 |
| sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 1038 | 1294 | 5.0E-24 |
| sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 989 | 1300 | 7.0E-24 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 1049 | 1294 | 9.0E-24 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 1049 | 1294 | 1.0E-23 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 1040 | 1300 | 2.0E-23 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 989 | 1259 | 2.0E-23 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 989 | 1268 | 2.0E-23 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 996 | 1300 | 3.0E-23 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 989 | 1268 | 4.0E-23 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 1040 | 1267 | 4.0E-23 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 1049 | 1302 | 4.0E-23 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 1040 | 1300 | 4.0E-23 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 989 | 1272 | 6.0E-23 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 989 | 1196 | 7.0E-23 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 971 | 1259 | 7.0E-23 |
| sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 989 | 1259 | 8.0E-23 |
| sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 989 | 1197 | 9.0E-23 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 996 | 1300 | 2.0E-22 |
| sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 984 | 1300 | 2.0E-22 |
| sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 980 | 1275 | 2.0E-22 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 989 | 1275 | 2.0E-22 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 989 | 1300 | 3.0E-22 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 989 | 1259 | 4.0E-22 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 989 | 1303 | 4.0E-22 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 989 | 1259 | 5.0E-22 |
| sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 934 | 1300 | 6.0E-22 |
| sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 984 | 1300 | 7.0E-22 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 1040 | 1264 | 7.0E-22 |
| sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 998 | 1303 | 9.0E-22 |
| sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 984 | 1300 | 1.0E-21 |
| sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 985 | 1300 | 1.0E-21 |
| sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 969 | 1259 | 1.0E-21 |
| sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 1038 | 1304 | 1.0E-21 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 1049 | 1302 | 1.0E-21 |
| sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 989 | 1259 | 1.0E-21 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 1040 | 1303 | 1.0E-21 |
| sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 1077 | 1304 | 1.0E-21 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 1040 | 1300 | 1.0E-21 |
| sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 1117 | 1304 | 2.0E-21 |
| sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 989 | 1260 | 2.0E-21 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 1045 | 1300 | 2.0E-21 |
| sp|P29829|GBB2_DROME | Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3 | 989 | 1300 | 2.0E-21 |
| sp|P87177|YB1C_SCHPO | Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 | 953 | 1300 | 2.0E-21 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 989 | 1259 | 3.0E-21 |
| sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 989 | 1259 | 3.0E-21 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 970 | 1195 | 3.0E-21 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 1045 | 1300 | 3.0E-21 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 998 | 1262 | 3.0E-21 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 989 | 1300 | 3.0E-21 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 1040 | 1303 | 3.0E-21 |
| sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 989 | 1196 | 3.0E-21 |
| sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 989 | 1196 | 3.0E-21 |
| sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 989 | 1196 | 3.0E-21 |
| sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 989 | 1196 | 3.0E-21 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 1069 | 1300 | 4.0E-21 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 989 | 1262 | 4.0E-21 |
| sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 979 | 1284 | 4.0E-21 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 1012 | 1300 | 4.0E-21 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 1040 | 1300 | 4.0E-21 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 4.0E-21 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 1038 | 1304 | 4.0E-21 |
| sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 1040 | 1303 | 4.0E-21 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 989 | 1198 | 5.0E-21 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 989 | 1259 | 5.0E-21 |
| sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 1040 | 1264 | 6.0E-21 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 1049 | 1302 | 6.0E-21 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 1043 | 1199 | 7.0E-21 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 1040 | 1300 | 7.0E-21 |
| sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 1044 | 1300 | 7.0E-21 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 1040 | 1264 | 8.0E-21 |
| sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 980 | 1288 | 8.0E-21 |
| sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 1040 | 1287 | 8.0E-21 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 1038 | 1294 | 8.0E-21 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 1040 | 1300 | 8.0E-21 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 985 | 1262 | 9.0E-21 |
| sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 1040 | 1300 | 9.0E-21 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 1040 | 1264 | 1.0E-20 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 1040 | 1303 | 1.0E-20 |
| sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 976 | 1260 | 1.0E-20 |
| sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 972 | 1196 | 1.0E-20 |
| sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 989 | 1305 | 2.0E-20 |
| sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 1032 | 1300 | 2.0E-20 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 1075 | 1300 | 2.0E-20 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 989 | 1197 | 2.0E-20 |
| sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 1045 | 1304 | 2.0E-20 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 1040 | 1300 | 2.0E-20 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 2.0E-20 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 2.0E-20 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 1040 | 1303 | 2.0E-20 |
| sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 989 | 1177 | 3.0E-20 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 1070 | 1300 | 3.0E-20 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 1040 | 1299 | 3.0E-20 |
| sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 966 | 1261 | 3.0E-20 |
| sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 1129 | 1304 | 3.0E-20 |
| sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 1040 | 1300 | 3.0E-20 |
| sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 969 | 1196 | 3.0E-20 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 1077 | 1303 | 4.0E-20 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 1040 | 1299 | 4.0E-20 |
| sp|P16371|GROU_DROME | Protein groucho OS=Drosophila melanogaster GN=gro PE=1 SV=3 | 984 | 1300 | 4.0E-20 |
| sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 1038 | 1303 | 4.0E-20 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 1040 | 1300 | 4.0E-20 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 1042 | 1300 | 4.0E-20 |
| sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 1038 | 1303 | 4.0E-20 |
| sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 1068 | 1300 | 4.0E-20 |
| sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 1068 | 1300 | 4.0E-20 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 1040 | 1300 | 4.0E-20 |
| sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 1069 | 1302 | 5.0E-20 |
| sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 989 | 1259 | 5.0E-20 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 1045 | 1300 | 5.0E-20 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 989 | 1238 | 5.0E-20 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 989 | 1238 | 5.0E-20 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 989 | 1300 | 5.0E-20 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 1040 | 1300 | 6.0E-20 |
| sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 974 | 1263 | 6.0E-20 |
| sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 974 | 1263 | 6.0E-20 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 989 | 1300 | 7.0E-20 |
| sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 1039 | 1199 | 7.0E-20 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 989 | 1302 | 7.0E-20 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 1040 | 1300 | 7.0E-20 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 985 | 1300 | 8.0E-20 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 1040 | 1300 | 8.0E-20 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 1040 | 1300 | 8.0E-20 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 989 | 1300 | 9.0E-20 |
| sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 972 | 1196 | 9.0E-20 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 1040 | 1299 | 1.0E-19 |
| sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 989 | 1191 | 1.0E-19 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 1040 | 1299 | 1.0E-19 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 1075 | 1300 | 1.0E-19 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 1040 | 1299 | 1.0E-19 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 1075 | 1300 | 1.0E-19 |
| sp|O13166|TLE2_DANRE | Protein groucho-2 OS=Danio rerio GN=gro2 PE=1 SV=1 | 969 | 1300 | 1.0E-19 |
| sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 1038 | 1260 | 1.0E-19 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 989 | 1284 | 1.0E-19 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 1005 | 1259 | 1.0E-19 |
| sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 1040 | 1300 | 2.0E-19 |
| sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 1040 | 1300 | 2.0E-19 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 1040 | 1300 | 2.0E-19 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 1040 | 1300 | 2.0E-19 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 1040 | 1300 | 2.0E-19 |
| sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 974 | 1263 | 2.0E-19 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 989 | 1284 | 2.0E-19 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 1040 | 1300 | 2.0E-19 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 1040 | 1300 | 2.0E-19 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 1040 | 1300 | 2.0E-19 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 1040 | 1300 | 2.0E-19 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 1040 | 1300 | 2.0E-19 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 1040 | 1300 | 2.0E-19 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 1040 | 1303 | 2.0E-19 |
| sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 972 | 1196 | 2.0E-19 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 1040 | 1300 | 2.0E-19 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 1070 | 1304 | 2.0E-19 |
| sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 990 | 1300 | 2.0E-19 |
| sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 993 | 1300 | 2.0E-19 |
| sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 972 | 1196 | 2.0E-19 |
| sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 2.0E-19 |
| sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 2.0E-19 |
| sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 1038 | 1294 | 2.0E-19 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 989 | 1284 | 2.0E-19 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 1040 | 1300 | 2.0E-19 |
| sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 1078 | 1301 | 2.0E-19 |
| sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 1078 | 1301 | 2.0E-19 |
| sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 999 | 1263 | 2.0E-19 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 989 | 1284 | 2.0E-19 |
| sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 974 | 1263 | 2.0E-19 |
| sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 999 | 1263 | 2.0E-19 |
| sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 1078 | 1304 | 3.0E-19 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 989 | 1198 | 3.0E-19 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 989 | 1198 | 3.0E-19 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 989 | 1300 | 3.0E-19 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 990 | 1304 | 3.0E-19 |
| sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 974 | 1263 | 3.0E-19 |
| sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 974 | 1263 | 3.0E-19 |
| sp|O13168|TLE1_DANRE | Protein groucho-1 (Fragment) OS=Danio rerio GN=gro1 PE=1 SV=1 | 969 | 1300 | 3.0E-19 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 1071 | 1303 | 4.0E-19 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 1071 | 1303 | 4.0E-19 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 1071 | 1303 | 4.0E-19 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 1071 | 1303 | 4.0E-19 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 1040 | 1304 | 4.0E-19 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 989 | 1203 | 4.0E-19 |
| sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 1001 | 1263 | 4.0E-19 |
| sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 1078 | 1301 | 4.0E-19 |
| sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 1039 | 1301 | 4.0E-19 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 990 | 1304 | 4.0E-19 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 1040 | 1300 | 4.0E-19 |
| sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 1039 | 1304 | 4.0E-19 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 1071 | 1303 | 5.0E-19 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 1040 | 1304 | 5.0E-19 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 1040 | 1304 | 5.0E-19 |
| sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 1078 | 1301 | 5.0E-19 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 989 | 1300 | 5.0E-19 |
| sp|Q62441|TLE4_MOUSE | Transducin-like enhancer protein 4 OS=Mus musculus GN=Tle4 PE=1 SV=4 | 969 | 1300 | 5.0E-19 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 1040 | 1303 | 5.0E-19 |
| sp|Q04727|TLE4_HUMAN | Transducin-like enhancer protein 4 OS=Homo sapiens GN=TLE4 PE=1 SV=3 | 969 | 1300 | 5.0E-19 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 1071 | 1303 | 6.0E-19 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 1075 | 1300 | 6.0E-19 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 1040 | 1299 | 6.0E-19 |
| sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 1072 | 1300 | 6.0E-19 |
| sp|Q07141|TLE4_RAT | Transducin-like enhancer protein 4 OS=Rattus norvegicus GN=Tle4 PE=1 SV=2 | 969 | 1300 | 6.0E-19 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 989 | 1196 | 6.0E-19 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 970 | 1195 | 7.0E-19 |
| sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 989 | 1205 | 7.0E-19 |
| sp|Q54PE0|PWP2_DICDI | Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1 | 1002 | 1261 | 7.0E-19 |
| sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 989 | 1198 | 7.0E-19 |
| sp|O42478|TLE4_XENLA | Transducin-like enhancer protein 4 OS=Xenopus laevis GN=tle4 PE=1 SV=2 | 969 | 1300 | 7.0E-19 |
| sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 989 | 1198 | 7.0E-19 |
| sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 1050 | 1260 | 7.0E-19 |
| sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 1039 | 1301 | 8.0E-19 |
| sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 989 | 1198 | 8.0E-19 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 984 | 1195 | 9.0E-19 |
| sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 1078 | 1301 | 9.0E-19 |
| sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 1078 | 1301 | 9.0E-19 |
| sp|Q08122|TLE3_MOUSE | Transducin-like enhancer protein 3 OS=Mus musculus GN=Tle3 PE=1 SV=3 | 969 | 1300 | 9.0E-19 |
| sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 1067 | 1300 | 9.0E-19 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 1128 | 1304 | 1.0E-18 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 1075 | 1300 | 1.0E-18 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 989 | 1189 | 1.0E-18 |
| sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 1072 | 1306 | 1.0E-18 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 989 | 1239 | 1.0E-18 |
| sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 1001 | 1290 | 1.0E-18 |
| sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 1001 | 1290 | 1.0E-18 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 1040 | 1303 | 1.0E-18 |
| sp|Q04726|TLE3_HUMAN | Transducin-like enhancer protein 3 OS=Homo sapiens GN=TLE3 PE=1 SV=2 | 969 | 1300 | 1.0E-18 |
| sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 969 | 1196 | 1.0E-18 |
| sp|Q9JIT3|TLE3_RAT | Transducin-like enhancer protein 3 OS=Rattus norvegicus GN=Tle3 PE=1 SV=1 | 969 | 1300 | 1.0E-18 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 1040 | 1300 | 1.0E-18 |
| sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 989 | 1198 | 1.0E-18 |
| sp|Q15269|PWP2_HUMAN | Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 | 980 | 1275 | 1.0E-18 |
| sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 981 | 1300 | 1.0E-18 |
| sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 1.0E-18 |
| sp|Q04725|TLE2_HUMAN | Transducin-like enhancer protein 2 OS=Homo sapiens GN=TLE2 PE=1 SV=2 | 973 | 1300 | 1.0E-18 |
| sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 1039 | 1303 | 1.0E-18 |
| sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 989 | 1300 | 1.0E-18 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 1063 | 1301 | 2.0E-18 |
| sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 989 | 1300 | 2.0E-18 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 1071 | 1303 | 2.0E-18 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 1040 | 1299 | 2.0E-18 |
| sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 1068 | 1300 | 2.0E-18 |
| sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 1068 | 1300 | 2.0E-18 |
| sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 1068 | 1300 | 2.0E-18 |
| sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 1068 | 1300 | 2.0E-18 |
| sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 1068 | 1300 | 2.0E-18 |
| sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 1078 | 1301 | 2.0E-18 |
| sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 1078 | 1301 | 2.0E-18 |
| sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 1078 | 1301 | 2.0E-18 |
| sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 1078 | 1301 | 2.0E-18 |
| sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 1129 | 1300 | 2.0E-18 |
| sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 989 | 1196 | 2.0E-18 |
| sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 1068 | 1300 | 2.0E-18 |
| sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 1028 | 1300 | 2.0E-18 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 1040 | 1300 | 2.0E-18 |
| sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 984 | 1183 | 3.0E-18 |
| sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 1125 | 1304 | 3.0E-18 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 1030 | 1299 | 3.0E-18 |
| sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 1068 | 1300 | 3.0E-18 |
| sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 1040 | 1300 | 3.0E-18 |
| sp|O42469|TLE1_XENLA | Transducin-like enhancer protein 1 OS=Xenopus laevis GN=esg1 PE=2 SV=1 | 973 | 1300 | 3.0E-18 |
| sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 1078 | 1301 | 3.0E-18 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 990 | 1302 | 3.0E-18 |
| sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 1040 | 1300 | 3.0E-18 |
| sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 1126 | 1304 | 4.0E-18 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 1071 | 1303 | 4.0E-18 |
| sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 1039 | 1301 | 4.0E-18 |
| sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 1078 | 1301 | 4.0E-18 |
| sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 1038 | 1303 | 4.0E-18 |
| sp|Q5RFQ3|PWP2_PONAB | Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 | 980 | 1272 | 4.0E-18 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 989 | 1300 | 5.0E-18 |
| sp|Q9WVB2|TLE2_MOUSE | Transducin-like enhancer protein 2 OS=Mus musculus GN=Tle2 PE=2 SV=1 | 973 | 1300 | 5.0E-18 |
| sp|Q04724|TLE1_HUMAN | Transducin-like enhancer protein 1 OS=Homo sapiens GN=TLE1 PE=1 SV=2 | 969 | 1300 | 5.0E-18 |
| sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 970 | 1259 | 5.0E-18 |
| sp|Q62440|TLE1_MOUSE | Transducin-like enhancer protein 1 OS=Mus musculus GN=Tle1 PE=1 SV=2 | 969 | 1300 | 6.0E-18 |
| sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 989 | 1195 | 6.0E-18 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 1071 | 1303 | 7.0E-18 |
| sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 1116 | 1304 | 7.0E-18 |
| sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 989 | 1196 | 7.0E-18 |
| sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 989 | 1196 | 7.0E-18 |
| sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 1068 | 1299 | 7.0E-18 |
| sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 989 | 1196 | 7.0E-18 |
| sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 1038 | 1304 | 7.0E-18 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 970 | 1259 | 8.0E-18 |
| sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 1039 | 1302 | 8.0E-18 |
| sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 1094 | 1300 | 8.0E-18 |
| sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 984 | 1259 | 8.0E-18 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 1129 | 1304 | 9.0E-18 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 1014 | 1300 | 9.0E-18 |
| sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 1038 | 1303 | 9.0E-18 |
| sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 1074 | 1304 | 1.0E-17 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 1075 | 1300 | 1.0E-17 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 989 | 1262 | 1.0E-17 |
| sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 1039 | 1301 | 1.0E-17 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 989 | 1300 | 1.0E-17 |
| sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 1042 | 1300 | 1.0E-17 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 989 | 1300 | 1.0E-17 |
| sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 1126 | 1300 | 1.0E-17 |
| sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 1126 | 1300 | 1.0E-17 |
| sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 1038 | 1294 | 1.0E-17 |
| sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 963 | 1166 | 2.0E-17 |
| sp|P29829|GBB2_DROME | Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3 | 1058 | 1300 | 2.0E-17 |
| sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 1038 | 1300 | 2.0E-17 |
| sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 991 | 1196 | 2.0E-17 |
| sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 1068 | 1299 | 2.0E-17 |
| sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 990 | 1300 | 2.0E-17 |
| sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 1040 | 1200 | 2.0E-17 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 1037 | 1262 | 2.0E-17 |
| sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 997 | 1259 | 2.0E-17 |
| sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 1039 | 1197 | 2.0E-17 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 989 | 1262 | 2.0E-17 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 1040 | 1300 | 2.0E-17 |
| sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 1039 | 1197 | 2.0E-17 |
| sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 1040 | 1303 | 2.0E-17 |
| sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 1040 | 1303 | 2.0E-17 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 1040 | 1300 | 2.0E-17 |
| sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 1039 | 1304 | 2.0E-17 |
| sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 998 | 1260 | 3.0E-17 |
| sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 1128 | 1304 | 3.0E-17 |
| sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 1128 | 1304 | 3.0E-17 |
| sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 1128 | 1304 | 3.0E-17 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 1040 | 1299 | 3.0E-17 |
| sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 1040 | 1299 | 3.0E-17 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 989 | 1262 | 3.0E-17 |
| sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 1039 | 1301 | 3.0E-17 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 1072 | 1304 | 3.0E-17 |
| sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 1040 | 1303 | 3.0E-17 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 3.0E-17 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 3.0E-17 |
| sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 1071 | 1300 | 3.0E-17 |
| sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 1040 | 1303 | 3.0E-17 |
| sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 1128 | 1304 | 4.0E-17 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 1071 | 1300 | 4.0E-17 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 1071 | 1300 | 4.0E-17 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 989 | 1196 | 4.0E-17 |
| sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 1124 | 1300 | 4.0E-17 |
| sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 1068 | 1300 | 4.0E-17 |
| sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 969 | 1196 | 4.0E-17 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 1040 | 1303 | 4.0E-17 |
| sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 1043 | 1220 | 4.0E-17 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 1002 | 1203 | 4.0E-17 |
| sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 1039 | 1306 | 4.0E-17 |
| sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 987 | 1199 | 5.0E-17 |
| sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 1039 | 1301 | 5.0E-17 |
| sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 1126 | 1300 | 5.0E-17 |
| sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 990 | 1300 | 5.0E-17 |
| sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 990 | 1300 | 5.0E-17 |
| sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 1071 | 1300 | 5.0E-17 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 1072 | 1294 | 5.0E-17 |
| sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 1039 | 1306 | 5.0E-17 |
| sp|P91341|PWP2_CAEEL | Periodic tryptophan protein 2 homolog OS=Caenorhabditis elegans GN=F55F8.3 PE=3 SV=2 | 953 | 1197 | 5.0E-17 |
| sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 1040 | 1303 | 5.0E-17 |
| sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 1039 | 1301 | 5.0E-17 |
| sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 970 | 1196 | 5.0E-17 |
| sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 969 | 1196 | 5.0E-17 |
| sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 1039 | 1301 | 6.0E-17 |
| sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 1039 | 1197 | 6.0E-17 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 6.0E-17 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 6.0E-17 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 6.0E-17 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 1040 | 1300 | 6.0E-17 |
| sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 1128 | 1304 | 7.0E-17 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 989 | 1262 | 7.0E-17 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 1072 | 1292 | 7.0E-17 |
| sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 1010 | 1302 | 7.0E-17 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 989 | 1262 | 7.0E-17 |
| sp|Q8VDD9|PHIP_MOUSE | PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 | 987 | 1284 | 7.0E-17 |
| sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 1039 | 1198 | 7.0E-17 |
| sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 1039 | 1197 | 7.0E-17 |
| sp|Q8WWQ0|PHIP_HUMAN | PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 | 987 | 1284 | 7.0E-17 |
| sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 992 | 1300 | 7.0E-17 |
| sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 997 | 1265 | 7.0E-17 |
| sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 1036 | 1284 | 7.0E-17 |
| sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 1129 | 1300 | 7.0E-17 |
| sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 1038 | 1294 | 8.0E-17 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 8.0E-17 |
| sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 1040 | 1303 | 8.0E-17 |
| sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 1129 | 1300 | 8.0E-17 |
| sp|Q9I9H8|APAF_DANRE | Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 | 991 | 1301 | 8.0E-17 |
| sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 983 | 1200 | 9.0E-17 |
| sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 989 | 1302 | 9.0E-17 |
| sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 969 | 1196 | 9.0E-17 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 9.0E-17 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 9.0E-17 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 989 | 1262 | 9.0E-17 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 9.0E-17 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 9.0E-17 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 9.0E-17 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 1040 | 1198 | 1.0E-16 |
| sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 1070 | 1303 | 1.0E-16 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 989 | 1262 | 1.0E-16 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 1043 | 1186 | 1.0E-16 |
| sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 989 | 1197 | 1.0E-16 |
| sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 1068 | 1300 | 1.0E-16 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 1072 | 1284 | 1.0E-16 |
| sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 1068 | 1299 | 1.0E-16 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 1072 | 1290 | 1.0E-16 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 1072 | 1292 | 1.0E-16 |
| sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 1039 | 1301 | 1.0E-16 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 1040 | 1300 | 1.0E-16 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 1.0E-16 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 1.0E-16 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 1124 | 1304 | 1.0E-16 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 1.0E-16 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 1.0E-16 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 1.0E-16 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 1.0E-16 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 1.0E-16 |
| sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 1051 | 1300 | 1.0E-16 |
| sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 1039 | 1301 | 1.0E-16 |
| sp|Q9C1X1|PWP2_SCHPO | Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1 | 999 | 1288 | 1.0E-16 |
| sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 1039 | 1301 | 1.0E-16 |
| sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 1039 | 1301 | 1.0E-16 |
| sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 1039 | 1301 | 1.0E-16 |
| sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 1039 | 1301 | 1.0E-16 |
| sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 1039 | 1301 | 1.0E-16 |
| sp|P23232|GBB_LOLFO | Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 | 1068 | 1300 | 1.0E-16 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 989 | 1197 | 1.0E-16 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 1071 | 1300 | 2.0E-16 |
| sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 1070 | 1302 | 2.0E-16 |
| sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 1068 | 1306 | 2.0E-16 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 1072 | 1292 | 2.0E-16 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 1072 | 1292 | 2.0E-16 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 1072 | 1292 | 2.0E-16 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 1072 | 1292 | 2.0E-16 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 1072 | 1292 | 2.0E-16 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 1072 | 1292 | 2.0E-16 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 1072 | 1292 | 2.0E-16 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 1072 | 1292 | 2.0E-16 |
| sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 1010 | 1302 | 2.0E-16 |
| sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 977 | 1261 | 2.0E-16 |
| sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 1039 | 1203 | 2.0E-16 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 2.0E-16 |
| sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 1039 | 1203 | 2.0E-16 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 989 | 1197 | 2.0E-16 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 1039 | 1203 | 2.0E-16 |
| sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 985 | 1300 | 2.0E-16 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 2.0E-16 |
| sp|Q8W117|SMU1_ARATH | Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 | 1087 | 1287 | 2.0E-16 |
| sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 1051 | 1306 | 2.0E-16 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 1040 | 1300 | 2.0E-16 |
| sp|Q54D08|LST8_DICDI | Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 | 996 | 1283 | 2.0E-16 |
| sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 2.0E-16 |
| sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 1040 | 1303 | 2.0E-16 |
| sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 1063 | 1301 | 2.0E-16 |
| sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 1039 | 1197 | 2.0E-16 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 1128 | 1304 | 3.0E-16 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 989 | 1196 | 3.0E-16 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 1072 | 1292 | 3.0E-16 |
| sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 1042 | 1302 | 3.0E-16 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 3.0E-16 |
| sp|Q8W117|SMU1_ARATH | Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 | 1045 | 1300 | 3.0E-16 |
| sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 988 | 1195 | 3.0E-16 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 3.0E-16 |
| sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 1129 | 1300 | 3.0E-16 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 1072 | 1304 | 3.0E-16 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1045 | 1300 | 3.0E-16 |
| sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 1072 | 1284 | 4.0E-16 |
| sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 1039 | 1301 | 4.0E-16 |
| sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 1039 | 1301 | 4.0E-16 |
| sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 989 | 1262 | 4.0E-16 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 1072 | 1292 | 4.0E-16 |
| sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 1039 | 1301 | 4.0E-16 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 4.0E-16 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 4.0E-16 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 4.0E-16 |
| sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 1039 | 1203 | 4.0E-16 |
| sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 1038 | 1294 | 4.0E-16 |
| sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 1129 | 1300 | 4.0E-16 |
| sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 1129 | 1300 | 4.0E-16 |
| sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 1129 | 1300 | 4.0E-16 |
| sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 1129 | 1300 | 4.0E-16 |
| sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 1129 | 1300 | 4.0E-16 |
| sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 1129 | 1300 | 4.0E-16 |
| sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 1129 | 1300 | 4.0E-16 |
| sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 989 | 1262 | 5.0E-16 |
| sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 1040 | 1300 | 5.0E-16 |
| sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 1039 | 1301 | 5.0E-16 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 5.0E-16 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 1124 | 1304 | 5.0E-16 |
| sp|Q5ZMC3|WSDU1_CHICK | WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 | 1044 | 1300 | 5.0E-16 |
| sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 1039 | 1264 | 5.0E-16 |
| sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 1071 | 1293 | 5.0E-16 |
| sp|Q5I0B9|ATG16_XENTR | Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 | 989 | 1287 | 5.0E-16 |
| sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 1045 | 1300 | 6.0E-16 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 1040 | 1303 | 6.0E-16 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 1070 | 1292 | 6.0E-16 |
| sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 989 | 1201 | 6.0E-16 |
| sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 972 | 1196 | 6.0E-16 |
| sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 1039 | 1259 | 6.0E-16 |
| sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 1039 | 1259 | 6.0E-16 |
| sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 1039 | 1301 | 6.0E-16 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 989 | 1262 | 6.0E-16 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 6.0E-16 |
| sp|Q62623|CDC20_RAT | Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 | 1000 | 1259 | 6.0E-16 |
| sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 1091 | 1301 | 6.0E-16 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 1034 | 1195 | 6.0E-16 |
| sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 1044 | 1304 | 6.0E-16 |
| sp|Q5H7C0|CDC20_PIG | Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 | 1000 | 1259 | 6.0E-16 |
| sp|Q5RAC9|A16L1_PONAB | Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 | 1074 | 1284 | 6.0E-16 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 1070 | 1292 | 7.0E-16 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 1072 | 1293 | 7.0E-16 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 7.0E-16 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 7.0E-16 |
| sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 1068 | 1299 | 7.0E-16 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 945 | 1198 | 7.0E-16 |
| sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 980 | 1199 | 7.0E-16 |
| sp|P49178|GBB_MAIZE | Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 | 1039 | 1303 | 7.0E-16 |
| sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 1038 | 1294 | 7.0E-16 |
| sp|Q12834|CDC20_HUMAN | Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 | 1000 | 1259 | 7.0E-16 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 1072 | 1292 | 8.0E-16 |
| sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 1124 | 1304 | 8.0E-16 |
| sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 1071 | 1300 | 8.0E-16 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 8.0E-16 |
| sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 1039 | 1197 | 8.0E-16 |
| sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 997 | 1259 | 8.0E-16 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 945 | 1198 | 8.0E-16 |
| sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 1038 | 1294 | 8.0E-16 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 1040 | 1300 | 9.0E-16 |
| sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 995 | 1196 | 9.0E-16 |
| sp|Q5I0B9|ATG16_XENTR | Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 | 1075 | 1284 | 9.0E-16 |
| sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 1052 | 1306 | 9.0E-16 |
| sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 1040 | 1197 | 1.0E-15 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 1075 | 1290 | 1.0E-15 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 1072 | 1290 | 1.0E-15 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 989 | 1262 | 1.0E-15 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 1077 | 1306 | 1.0E-15 |
| sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 1068 | 1299 | 1.0E-15 |
| sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 1068 | 1299 | 1.0E-15 |
| sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 1068 | 1299 | 1.0E-15 |
| sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 1068 | 1299 | 1.0E-15 |
| sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 1068 | 1299 | 1.0E-15 |
| sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 1068 | 1299 | 1.0E-15 |
| sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 995 | 1196 | 1.0E-15 |
| sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 995 | 1196 | 1.0E-15 |
| sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 1052 | 1300 | 1.0E-15 |
| sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 1039 | 1304 | 1.0E-15 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 945 | 1198 | 1.0E-15 |
| sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 1084 | 1264 | 1.0E-15 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 945 | 1198 | 1.0E-15 |
| sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 980 | 1199 | 1.0E-15 |
| sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 1018 | 1294 | 1.0E-15 |
| sp|C5MJE8|LIS1_CANTT | Nuclear distribution protein PAC1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PAC1 PE=3 SV=1 | 985 | 1283 | 1.0E-15 |
| sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 980 | 1199 | 1.0E-15 |
| sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 1082 | 1301 | 1.0E-15 |
| sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 1082 | 1301 | 1.0E-15 |
| sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 1082 | 1301 | 1.0E-15 |
| sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 1082 | 1301 | 1.0E-15 |
| sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 1082 | 1301 | 1.0E-15 |
| sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 1082 | 1301 | 1.0E-15 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 1070 | 1292 | 2.0E-15 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 1043 | 1186 | 2.0E-15 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 1049 | 1197 | 2.0E-15 |
| sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 1076 | 1284 | 2.0E-15 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 1070 | 1292 | 2.0E-15 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 989 | 1262 | 2.0E-15 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 989 | 1262 | 2.0E-15 |
| sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 1068 | 1300 | 2.0E-15 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 1128 | 1300 | 2.0E-15 |
| sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 989 | 1200 | 2.0E-15 |
| sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 1039 | 1198 | 2.0E-15 |
| sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 1129 | 1300 | 2.0E-15 |
| sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 1129 | 1300 | 2.0E-15 |
| sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 1072 | 1300 | 2.0E-15 |
| sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 1072 | 1300 | 2.0E-15 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 1072 | 1300 | 2.0E-15 |
| sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 1068 | 1299 | 2.0E-15 |
| sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 1068 | 1299 | 2.0E-15 |
| sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 1068 | 1299 | 2.0E-15 |
| sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 1039 | 1198 | 2.0E-15 |
| sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 1039 | 1259 | 2.0E-15 |
| sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 1082 | 1301 | 2.0E-15 |
| sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 993 | 1260 | 2.0E-15 |
| sp|Q8BU03|PWP2_MOUSE | Periodic tryptophan protein 2 homolog OS=Mus musculus GN=Pwp2 PE=1 SV=1 | 980 | 1272 | 2.0E-15 |
| sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 990 | 1262 | 2.0E-15 |
| sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 1051 | 1306 | 2.0E-15 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 1040 | 1300 | 2.0E-15 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 1040 | 1300 | 2.0E-15 |
| sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 1031 | 1301 | 2.0E-15 |
| sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 993 | 1259 | 2.0E-15 |
| sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 1039 | 1304 | 2.0E-15 |
| sp|Q6RI45|BRWD3_HUMAN | Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 | 1077 | 1302 | 2.0E-15 |
| sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 1039 | 1199 | 2.0E-15 |
| sp|Q676U5|A16L1_HUMAN | Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 | 989 | 1287 | 2.0E-15 |
| sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 1003 | 1284 | 2.0E-15 |
| sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 999 | 1259 | 2.0E-15 |
| sp|A2AHJ4|BRWD3_MOUSE | Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1 | 1077 | 1302 | 2.0E-15 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 994 | 1187 | 3.0E-15 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 1124 | 1304 | 3.0E-15 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 989 | 1262 | 3.0E-15 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 989 | 1262 | 3.0E-15 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 989 | 1262 | 3.0E-15 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 989 | 1262 | 3.0E-15 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 989 | 1262 | 3.0E-15 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 989 | 1262 | 3.0E-15 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 1012 | 1300 | 3.0E-15 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 1040 | 1300 | 3.0E-15 |
| sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 984 | 1198 | 3.0E-15 |
| sp|Q676U5|A16L1_HUMAN | Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 | 1074 | 1284 | 3.0E-15 |
| sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 999 | 1259 | 3.0E-15 |
| sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 999 | 1259 | 3.0E-15 |
| sp|P93397|GBB1_TOBAC | Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1 | 1039 | 1302 | 3.0E-15 |
| sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 1071 | 1300 | 3.0E-15 |
| sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 989 | 1275 | 3.0E-15 |
| sp|Q9JJ66|CDC20_MOUSE | Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 | 1000 | 1259 | 3.0E-15 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 989 | 1197 | 4.0E-15 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 1042 | 1259 | 4.0E-15 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 1070 | 1292 | 4.0E-15 |
| sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 1046 | 1284 | 4.0E-15 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 989 | 1262 | 4.0E-15 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 989 | 1262 | 4.0E-15 |
| sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 1027 | 1284 | 4.0E-15 |
| sp|Q8C0J2|A16L1_MOUSE | Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 | 1074 | 1284 | 4.0E-15 |
| sp|Q5FVN8|WSDU1_RAT | WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 | 989 | 1259 | 4.0E-15 |
| sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 1040 | 1303 | 4.0E-15 |
| sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 999 | 1259 | 4.0E-15 |
| sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 987 | 1300 | 4.0E-15 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 1049 | 1202 | 5.0E-15 |
| sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 1039 | 1301 | 5.0E-15 |
| sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 989 | 1262 | 5.0E-15 |
| sp|Q54D08|LST8_DICDI | Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 | 989 | 1198 | 5.0E-15 |
| sp|Q5FVN8|WSDU1_RAT | WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 | 1044 | 1302 | 5.0E-15 |
| sp|Q40507|GBB3_TOBAC | Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1 | 1039 | 1302 | 5.0E-15 |
| sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 1039 | 1198 | 5.0E-15 |
| sp|P93563|GBB_SOLTU | Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1 | 1074 | 1300 | 5.0E-15 |
| sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 999 | 1259 | 5.0E-15 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 998 | 1262 | 6.0E-15 |
| sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 1046 | 1284 | 6.0E-15 |
| sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 1129 | 1293 | 6.0E-15 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1002 | 1200 | 6.0E-15 |
| sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 1126 | 1300 | 6.0E-15 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 1049 | 1300 | 6.0E-15 |
| sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 1129 | 1304 | 7.0E-15 |
| sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 989 | 1262 | 7.0E-15 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 1124 | 1304 | 7.0E-15 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 1039 | 1303 | 7.0E-15 |
| sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 1129 | 1300 | 7.0E-15 |
| sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 989 | 1259 | 7.0E-15 |
| sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 1064 | 1304 | 7.0E-15 |
| sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 1040 | 1294 | 7.0E-15 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 989 | 1199 | 8.0E-15 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 1049 | 1300 | 8.0E-15 |
| sp|Q9D0I6|WSDU1_MOUSE | WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 | 989 | 1259 | 8.0E-15 |
| sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 1132 | 1304 | 9.0E-15 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 985 | 1280 | 9.0E-15 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 985 | 1280 | 9.0E-15 |
| sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 989 | 1260 | 9.0E-15 |
| sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 989 | 1300 | 9.0E-15 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 1070 | 1291 | 1.0E-14 |
| sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 1077 | 1293 | 1.0E-14 |
| sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 987 | 1300 | 1.0E-14 |
| sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 1043 | 1304 | 1.0E-14 |
| sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 1002 | 1302 | 1.0E-14 |
| sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 1040 | 1198 | 1.0E-14 |
| sp|Q5XGE2|UTP15_XENTR | U3 small nucleolar RNA-associated protein 15 homolog OS=Xenopus tropicalis GN=utp15 PE=2 SV=1 | 1044 | 1284 | 1.0E-14 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 1124 | 1304 | 2.0E-14 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 1124 | 1304 | 2.0E-14 |
| sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 1037 | 1202 | 2.0E-14 |
| sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 1049 | 1202 | 2.0E-14 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 1039 | 1303 | 2.0E-14 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 989 | 1262 | 2.0E-14 |
| sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 1070 | 1300 | 2.0E-14 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1002 | 1200 | 2.0E-14 |
| sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 1129 | 1300 | 2.0E-14 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 989 | 1259 | 2.0E-14 |
| sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 1129 | 1293 | 2.0E-14 |
| sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 1067 | 1299 | 2.0E-14 |
| sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 986 | 1283 | 2.0E-14 |
| sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 1039 | 1304 | 2.0E-14 |
| sp|Q8N9V3|WSDU1_HUMAN | WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 | 981 | 1302 | 2.0E-14 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 1049 | 1300 | 2.0E-14 |
| sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 997 | 1265 | 2.0E-14 |
| sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 982 | 1199 | 2.0E-14 |
| sp|Q68EI0|WDR18_DANRE | WD repeat-containing protein 18 OS=Danio rerio GN=wdr18 PE=2 SV=1 | 1040 | 1285 | 2.0E-14 |
| sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 1003 | 1284 | 2.0E-14 |
| sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 990 | 1300 | 2.0E-14 |
| sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 989 | 1202 | 2.0E-14 |
| sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 1039 | 1304 | 2.0E-14 |
| sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 1043 | 1265 | 2.0E-14 |
| sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 990 | 1300 | 2.0E-14 |
| sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 1039 | 1199 | 2.0E-14 |
| sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 1043 | 1265 | 2.0E-14 |
| sp|Q54MZ3|CDC20_DICDI | Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 | 983 | 1259 | 2.0E-14 |
| sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 1039 | 1260 | 3.0E-14 |
| sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 1039 | 1260 | 3.0E-14 |
| sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 1039 | 1260 | 3.0E-14 |
| sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 1039 | 1260 | 3.0E-14 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 1072 | 1289 | 3.0E-14 |
| sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 1124 | 1287 | 3.0E-14 |
| sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 1124 | 1287 | 3.0E-14 |
| sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 989 | 1202 | 3.0E-14 |
| sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 974 | 1198 | 3.0E-14 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 1129 | 1300 | 3.0E-14 |
| sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 1049 | 1288 | 3.0E-14 |
| sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 1039 | 1198 | 3.0E-14 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 1040 | 1300 | 3.0E-14 |
| sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 1129 | 1293 | 3.0E-14 |
| sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 1039 | 1198 | 3.0E-14 |
| sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 1039 | 1198 | 3.0E-14 |
| sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 1039 | 1198 | 3.0E-14 |
| sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 1039 | 1198 | 3.0E-14 |
| sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 1039 | 1198 | 3.0E-14 |
| sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 1039 | 1198 | 3.0E-14 |
| sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 1039 | 1198 | 3.0E-14 |
| sp|Q5RAC9|A16L1_PONAB | Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 | 989 | 1286 | 3.0E-14 |
| sp|P93397|GBB1_TOBAC | Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1 | 1074 | 1300 | 3.0E-14 |
| sp|Q40507|GBB3_TOBAC | Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1 | 1074 | 1300 | 3.0E-14 |
| sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 984 | 1199 | 3.0E-14 |
| sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 984 | 1199 | 3.0E-14 |
| sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 993 | 1282 | 3.0E-14 |
| sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 984 | 1199 | 3.0E-14 |
| sp|Q922B6|TRAF7_MOUSE | E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 | 989 | 1301 | 3.0E-14 |
| sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 1040 | 1300 | 3.0E-14 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 989 | 1197 | 4.0E-14 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 989 | 1197 | 4.0E-14 |
| sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 989 | 1197 | 4.0E-14 |
| sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 988 | 1260 | 4.0E-14 |
| sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 1005 | 1200 | 4.0E-14 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1072 | 1300 | 4.0E-14 |
| sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 1035 | 1260 | 4.0E-14 |
| sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 1035 | 1260 | 4.0E-14 |
| sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 989 | 1264 | 4.0E-14 |
| sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 1037 | 1294 | 4.0E-14 |
| sp|Q6Q0C0|TRAF7_HUMAN | E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 | 989 | 1301 | 4.0E-14 |
| sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 1142 | 1300 | 4.0E-14 |
| sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 989 | 1199 | 4.0E-14 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 1070 | 1286 | 5.0E-14 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 1051 | 1305 | 5.0E-14 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1072 | 1300 | 5.0E-14 |
| sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 1045 | 1260 | 5.0E-14 |
| sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 1042 | 1300 | 5.0E-14 |
| sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 1035 | 1260 | 5.0E-14 |
| sp|Q8C0J2|A16L1_MOUSE | Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 | 989 | 1286 | 5.0E-14 |
| sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 990 | 1300 | 5.0E-14 |
| sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 1142 | 1300 | 5.0E-14 |
| sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 996 | 1302 | 5.0E-14 |
| sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 1039 | 1304 | 5.0E-14 |
| sp|P29829|GBB2_DROME | Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3 | 983 | 1195 | 6.0E-14 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 1074 | 1300 | 6.0E-14 |
| sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 1045 | 1305 | 6.0E-14 |
| sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 1039 | 1263 | 6.0E-14 |
| sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 1039 | 1264 | 6.0E-14 |
| sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 1122 | 1304 | 6.0E-14 |
| sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 1039 | 1264 | 6.0E-14 |
| sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 1039 | 1264 | 6.0E-14 |
| sp|P93398|GBB2_TOBAC | Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1 | 1074 | 1300 | 6.0E-14 |
| sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 1072 | 1306 | 7.0E-14 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 1074 | 1300 | 7.0E-14 |
| sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 1027 | 1283 | 7.0E-14 |
| sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 1027 | 1283 | 7.0E-14 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 1069 | 1269 | 7.0E-14 |
| sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 1039 | 1198 | 7.0E-14 |
| sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 1077 | 1305 | 7.0E-14 |
| sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 989 | 1272 | 7.0E-14 |
| sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 1124 | 1284 | 8.0E-14 |
| sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 984 | 1260 | 8.0E-14 |
| sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 989 | 1264 | 8.0E-14 |
| sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 1039 | 1300 | 8.0E-14 |
| sp|A7MB12|UTP15_BOVIN | U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 | 1044 | 1259 | 8.0E-14 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 1124 | 1304 | 9.0E-14 |
| sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 1039 | 1263 | 9.0E-14 |
| sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 989 | 1264 | 9.0E-14 |
| sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 1039 | 1304 | 9.0E-14 |
| sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 1159 | 1300 | 1.0E-13 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 1127 | 1304 | 1.0E-13 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 1049 | 1202 | 1.0E-13 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 1074 | 1300 | 1.0E-13 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 998 | 1306 | 1.0E-13 |
| sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 989 | 1198 | 1.0E-13 |
| sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 1039 | 1260 | 1.0E-13 |
| sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 1035 | 1260 | 1.0E-13 |
| sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 989 | 1197 | 1.0E-13 |
| sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 1035 | 1260 | 1.0E-13 |
| sp|P23232|GBB_LOLFO | Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 | 1039 | 1301 | 1.0E-13 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 1124 | 1304 | 1.0E-13 |
| sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 989 | 1202 | 1.0E-13 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 993 | 1266 | 1.0E-13 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 993 | 1266 | 1.0E-13 |
| sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 1036 | 1198 | 1.0E-13 |
| sp|P93563|GBB_SOLTU | Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1 | 1039 | 1302 | 1.0E-13 |
| sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 1043 | 1265 | 1.0E-13 |
| sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 1043 | 1265 | 1.0E-13 |
| sp|P49177|GBB_ARATH | Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1 | 1074 | 1300 | 1.0E-13 |
| sp|Q10282|GBB_SCHPO | Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 | 998 | 1261 | 1.0E-13 |
| sp|Q7ZXZ2|UTP15_XENLA | U3 small nucleolar RNA-associated protein 15 homolog OS=Xenopus laevis GN=utp15 PE=2 SV=1 | 1044 | 1284 | 1.0E-13 |
| sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 1001 | 1199 | 1.0E-13 |
| sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 1043 | 1265 | 1.0E-13 |
| sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 988 | 1195 | 1.0E-13 |
| sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 996 | 1305 | 1.0E-13 |
| sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 1040 | 1303 | 1.0E-13 |
| sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 1002 | 1302 | 1.0E-13 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 1039 | 1259 | 1.0E-13 |
| sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 1137 | 1300 | 2.0E-13 |
| sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 1037 | 1202 | 2.0E-13 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 1074 | 1300 | 2.0E-13 |
| sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 1027 | 1283 | 2.0E-13 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 998 | 1305 | 2.0E-13 |
| sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 980 | 1202 | 2.0E-13 |
| sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 1049 | 1202 | 2.0E-13 |
| sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 1039 | 1282 | 2.0E-13 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 1046 | 1300 | 2.0E-13 |
| sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 1039 | 1282 | 2.0E-13 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 993 | 1195 | 2.0E-13 |
| sp|P93398|GBB2_TOBAC | Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1 | 1039 | 1302 | 2.0E-13 |
| sp|Q8C7V3|UTP15_MOUSE | U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 | 1045 | 1259 | 2.0E-13 |
| sp|Q9FUY2|LEUNG_ARATH | Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 | 975 | 1259 | 2.0E-13 |
| sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 996 | 1304 | 2.0E-13 |
| sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 1039 | 1199 | 2.0E-13 |
| sp|Q8TED0|UTP15_HUMAN | U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 | 1044 | 1259 | 2.0E-13 |
| sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 1070 | 1306 | 2.0E-13 |
| sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 1039 | 1199 | 2.0E-13 |
| sp|Q9W5Z5|WSB1_TAKRU | WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 | 1045 | 1300 | 2.0E-13 |
| sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 1040 | 1303 | 2.0E-13 |
| sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 1072 | 1306 | 3.0E-13 |
| sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 1137 | 1300 | 3.0E-13 |
| sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 1037 | 1202 | 3.0E-13 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 998 | 1304 | 3.0E-13 |
| sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 1124 | 1289 | 3.0E-13 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 1091 | 1300 | 3.0E-13 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 993 | 1266 | 3.0E-13 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 993 | 1266 | 3.0E-13 |
| sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 1039 | 1282 | 3.0E-13 |
| sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 1039 | 1282 | 3.0E-13 |
| sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 1039 | 1282 | 3.0E-13 |
| sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 989 | 1262 | 3.0E-13 |
| sp|Q10282|GBB_SCHPO | Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 | 1045 | 1303 | 3.0E-13 |
| sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 988 | 1195 | 3.0E-13 |
| sp|Q54S59|WDR61_DICDI | WD repeat-containing protein 61 homolog OS=Dictyostelium discoideum GN=wdr61 PE=3 SV=1 | 986 | 1284 | 3.0E-13 |
| sp|O43071|PRP17_SCHPO | Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 | 1045 | 1292 | 3.0E-13 |
| sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 988 | 1195 | 3.0E-13 |
| sp|Q6NNP0|ATG16_ARATH | Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 | 1002 | 1271 | 3.0E-13 |
| sp|A6ZQL5|MDV1_YEAS7 | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 | 989 | 1301 | 3.0E-13 |
| sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 971 | 1263 | 3.0E-13 |
| sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 988 | 1195 | 3.0E-13 |
| sp|P47025|MDV1_YEAST | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 | 989 | 1301 | 3.0E-13 |
| sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 1040 | 1304 | 3.0E-13 |
| sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 989 | 1197 | 4.0E-13 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 1040 | 1284 | 4.0E-13 |
| sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 1039 | 1282 | 4.0E-13 |
| sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 1039 | 1282 | 4.0E-13 |
| sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 1039 | 1282 | 4.0E-13 |
| sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 988 | 1195 | 4.0E-13 |
| sp|Q758R7|MDV1_ASHGO | Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 | 1052 | 1197 | 4.0E-13 |
| sp|P38123|SWD3_YEAST | COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1 | 995 | 1272 | 4.0E-13 |
| sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 989 | 1195 | 5.0E-13 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 1127 | 1300 | 5.0E-13 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 989 | 1301 | 5.0E-13 |
| sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 1041 | 1199 | 5.0E-13 |
| sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 1077 | 1305 | 5.0E-13 |
| sp|Q10282|GBB_SCHPO | Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 | 980 | 1195 | 5.0E-13 |
| sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 1039 | 1199 | 5.0E-13 |
| sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 1039 | 1199 | 5.0E-13 |
| sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 1039 | 1199 | 5.0E-13 |
| sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 1039 | 1199 | 5.0E-13 |
| sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 1039 | 1199 | 5.0E-13 |
| sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 989 | 1303 | 5.0E-13 |
| sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 986 | 1273 | 5.0E-13 |
| sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 988 | 1195 | 5.0E-13 |
| sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 1039 | 1199 | 5.0E-13 |
| sp|Q9EQ15|GNB1L_MOUSE | Guanine nucleotide-binding protein subunit beta-like protein 1 OS=Mus musculus GN=Gnb1l PE=2 SV=2 | 1014 | 1197 | 5.0E-13 |
| sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 993 | 1195 | 5.0E-13 |
| sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 1075 | 1300 | 6.0E-13 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 1077 | 1300 | 6.0E-13 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 1037 | 1202 | 6.0E-13 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 1037 | 1202 | 6.0E-13 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 993 | 1195 | 6.0E-13 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 1070 | 1306 | 6.0E-13 |
| sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 989 | 1304 | 6.0E-13 |
| sp|Q9LJR3|SPA3_ARATH | Protein SPA1-RELATED 3 OS=Arabidopsis thaliana GN=SPA3 PE=1 SV=1 | 974 | 1256 | 6.0E-13 |
| sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 1035 | 1301 | 7.0E-13 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 7.0E-13 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 7.0E-13 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 1077 | 1303 | 7.0E-13 |
| sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 1041 | 1300 | 7.0E-13 |
| sp|Q9R099|TBL2_MOUSE | Transducin beta-like protein 2 OS=Mus musculus GN=Tbl2 PE=1 SV=2 | 1031 | 1260 | 7.0E-13 |
| sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 1039 | 1197 | 7.0E-13 |
| sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 1040 | 1261 | 7.0E-13 |
| sp|Q2KJH4|WDR1_BOVIN | WD repeat-containing protein 1 OS=Bos taurus GN=WDR1 PE=2 SV=3 | 989 | 1298 | 7.0E-13 |
| sp|A2RRU3|UTP15_RAT | U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 | 1045 | 1259 | 7.0E-13 |
| sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 1027 | 1283 | 8.0E-13 |
| sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 1027 | 1283 | 8.0E-13 |
| sp|B4LS78|WDR12_DROVI | Ribosome biogenesis protein WDR12 homolog OS=Drosophila virilis GN=GJ17641 PE=3 SV=1 | 1049 | 1299 | 8.0E-13 |
| sp|P93339|GBB_NICPL | Guanine nucleotide-binding protein subunit beta OS=Nicotiana plumbaginifolia PE=2 SV=1 | 1074 | 1300 | 8.0E-13 |
| sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 1040 | 1304 | 8.0E-13 |
| sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 887 | 1259 | 8.0E-13 |
| sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 1072 | 1294 | 8.0E-13 |
| sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 989 | 1202 | 9.0E-13 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 1040 | 1294 | 9.0E-13 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 1109 | 1301 | 9.0E-13 |
| sp|Q6PAX7|WDR1B_XENLA | WD repeat-containing protein 1-B OS=Xenopus laevis GN=wdr1-b PE=2 SV=1 | 989 | 1294 | 9.0E-13 |
| sp|Q09150|REC14_SCHPO | Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1 | 1042 | 1200 | 9.0E-13 |
| sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 1049 | 1202 | 1.0E-12 |
| sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 1027 | 1283 | 1.0E-12 |
| sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 1027 | 1283 | 1.0E-12 |
| sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 1033 | 1284 | 1.0E-12 |
| sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 1073 | 1304 | 1.0E-12 |
| sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 980 | 1202 | 1.0E-12 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 1.0E-12 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 1.0E-12 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 1.0E-12 |
| sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 1070 | 1294 | 1.0E-12 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 1.0E-12 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 1.0E-12 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 1.0E-12 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 1124 | 1304 | 1.0E-12 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 1.0E-12 |
| sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 1040 | 1197 | 1.0E-12 |
| sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 1049 | 1300 | 1.0E-12 |
| sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 1040 | 1261 | 1.0E-12 |
| sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 1071 | 1304 | 1.0E-12 |
| sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 1039 | 1199 | 1.0E-12 |
| sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 1070 | 1304 | 1.0E-12 |
| sp|B3MJV8|WDR12_DROAN | Ribosome biogenesis protein WDR12 homolog OS=Drosophila ananassae GN=GF14067 PE=3 SV=1 | 1048 | 1299 | 1.0E-12 |
| sp|Q9W7F2|WDR1A_XENLA | WD repeat-containing protein 1-A OS=Xenopus laevis GN=wdr1-a PE=2 SV=2 | 989 | 1294 | 1.0E-12 |
| sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 1040 | 1300 | 1.0E-12 |
| sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 1126 | 1300 | 2.0E-12 |
| sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 1137 | 1300 | 2.0E-12 |
| sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 1129 | 1304 | 2.0E-12 |
| sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 1027 | 1283 | 2.0E-12 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 1075 | 1303 | 2.0E-12 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1049 | 1260 | 2.0E-12 |
| sp|P49178|GBB_MAIZE | Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 | 1074 | 1299 | 2.0E-12 |
| sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 1001 | 1204 | 2.0E-12 |
| sp|Q9D0I6|WSDU1_MOUSE | WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 | 981 | 1302 | 2.0E-12 |
| sp|P49177|GBB_ARATH | Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1 | 1039 | 1302 | 2.0E-12 |
| sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 1043 | 1300 | 2.0E-12 |
| sp|Q8CGF6|WDR47_MOUSE | WD repeat-containing protein 47 OS=Mus musculus GN=Wdr47 PE=1 SV=2 | 963 | 1259 | 2.0E-12 |
| sp|Q9Y4P3|TBL2_HUMAN | Transducin beta-like protein 2 OS=Homo sapiens GN=TBL2 PE=1 SV=1 | 1031 | 1260 | 2.0E-12 |
| sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 1030 | 1265 | 2.0E-12 |
| sp|C4YPI7|LIS1_CANAW | Nuclear distribution protein PAC1 OS=Candida albicans (strain WO-1) GN=PAC1 PE=3 SV=1 | 990 | 1283 | 2.0E-12 |
| sp|Q5A7Q6|LIS1_CANAL | Nuclear distribution protein PAC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAC1 PE=3 SV=1 | 990 | 1283 | 2.0E-12 |
| sp|Q94BM7|SPA4_ARATH | Protein SPA1-RELATED 4 OS=Arabidopsis thaliana GN=SPA4 PE=1 SV=1 | 974 | 1197 | 2.0E-12 |
| sp|Q9Z1Z2|STRAP_MOUSE | Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 | 986 | 1195 | 2.0E-12 |
| sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 1040 | 1261 | 2.0E-12 |
| sp|O94967|WDR47_HUMAN | WD repeat-containing protein 47 OS=Homo sapiens GN=WDR47 PE=1 SV=1 | 989 | 1259 | 2.0E-12 |
| sp|B9WD30|LIS1_CANDC | Nuclear distribution protein PAC1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PAC1 PE=3 SV=1 | 990 | 1283 | 2.0E-12 |
| sp|A7THX0|MDV1_VANPO | Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 | 989 | 1197 | 2.0E-12 |
| sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 984 | 1195 | 2.0E-12 |
| sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 1075 | 1260 | 3.0E-12 |
| sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 1142 | 1300 | 3.0E-12 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 1077 | 1303 | 3.0E-12 |
| sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 989 | 1197 | 3.0E-12 |
| sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 1040 | 1197 | 3.0E-12 |
| sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 989 | 1197 | 3.0E-12 |
| sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 989 | 1197 | 3.0E-12 |
| sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 989 | 1197 | 3.0E-12 |
| sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 989 | 1197 | 3.0E-12 |
| sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 990 | 1277 | 3.0E-12 |
| sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 981 | 1302 | 3.0E-12 |
| sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 980 | 1202 | 3.0E-12 |
| sp|Q9BVC4|LST8_HUMAN | Target of rapamycin complex subunit LST8 OS=Homo sapiens GN=MLST8 PE=1 SV=1 | 986 | 1277 | 3.0E-12 |
| sp|Q9DCJ1|LST8_MOUSE | Target of rapamycin complex subunit LST8 OS=Mus musculus GN=Mlst8 PE=1 SV=1 | 986 | 1277 | 3.0E-12 |
| sp|O02482|UNC37_CAEEL | Transcription factor unc-37 OS=Caenorhabditis elegans GN=unc-37 PE=1 SV=1 | 987 | 1301 | 3.0E-12 |
| sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 989 | 1304 | 3.0E-12 |
| sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 1049 | 1202 | 4.0E-12 |
| sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 996 | 1176 | 4.0E-12 |
| sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 989 | 1221 | 4.0E-12 |
| sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 989 | 1202 | 4.0E-12 |
| sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 1117 | 1300 | 4.0E-12 |
| sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 1071 | 1284 | 4.0E-12 |
| sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 1030 | 1300 | 4.0E-12 |
| sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 989 | 1198 | 5.0E-12 |
| sp|Q5ZMC3|WSDU1_CHICK | WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 | 989 | 1263 | 5.0E-12 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 1124 | 1306 | 6.0E-12 |
| sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 989 | 1198 | 6.0E-12 |
| sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 989 | 1198 | 6.0E-12 |
| sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 989 | 1197 | 6.0E-12 |
| sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 989 | 1198 | 6.0E-12 |
| sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 989 | 1197 | 6.0E-12 |
| sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 1040 | 1197 | 6.0E-12 |
| sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 989 | 1264 | 6.0E-12 |
| sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 1072 | 1284 | 6.0E-12 |
| sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 1072 | 1284 | 6.0E-12 |
| sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 1072 | 1284 | 6.0E-12 |
| sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 1072 | 1284 | 6.0E-12 |
| sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 1072 | 1284 | 6.0E-12 |
| sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 1072 | 1284 | 6.0E-12 |
| sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 989 | 1260 | 7.0E-12 |
| sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 989 | 1202 | 7.0E-12 |
| sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 1142 | 1300 | 7.0E-12 |
| sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 1040 | 1197 | 7.0E-12 |
| sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 989 | 1197 | 7.0E-12 |
| sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 1072 | 1284 | 7.0E-12 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 1124 | 1306 | 8.0E-12 |
| sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 1072 | 1306 | 8.0E-12 |
| sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 1072 | 1306 | 8.0E-12 |
| sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 1049 | 1202 | 8.0E-12 |
| sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 1049 | 1202 | 8.0E-12 |
| sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 1040 | 1303 | 8.0E-12 |
| sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 1072 | 1264 | 8.0E-12 |
| sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 1049 | 1202 | 9.0E-12 |
| sp|Q8WWQ0|PHIP_HUMAN | PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 | 1077 | 1302 | 9.0E-12 |
| sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 1116 | 1304 | 9.0E-12 |
| sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 989 | 1260 | 9.0E-12 |
| sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 1072 | 1284 | 9.0E-12 |
| sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 1073 | 1301 | 1.0E-11 |
| sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 1137 | 1300 | 1.0E-11 |
| sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 1137 | 1300 | 1.0E-11 |
| sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 1160 | 1301 | 1.0E-11 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 1092 | 1304 | 1.0E-11 |
| sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 989 | 1202 | 1.0E-11 |
| sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 1162 | 1300 | 1.0E-11 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 1039 | 1304 | 1.0E-11 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1049 | 1260 | 1.0E-11 |
| sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 989 | 1197 | 1.0E-11 |
| sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 984 | 1260 | 1.0E-11 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 1040 | 1197 | 1.0E-11 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 1040 | 1197 | 1.0E-11 |
| sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 989 | 1197 | 1.0E-11 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 1027 | 1195 | 1.0E-11 |
| sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 1142 | 1300 | 1.0E-11 |
| sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 989 | 1260 | 1.0E-11 |
| sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 989 | 1304 | 1.0E-11 |
| sp|P93339|GBB_NICPL | Guanine nucleotide-binding protein subunit beta OS=Nicotiana plumbaginifolia PE=2 SV=1 | 1039 | 1302 | 1.0E-11 |
| sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 1040 | 1198 | 2.0E-11 |
| sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 989 | 1195 | 2.0E-11 |
| sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 984 | 1260 | 2.0E-11 |
| sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 989 | 1197 | 2.0E-11 |
| sp|Q8VDD9|PHIP_MOUSE | PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 | 1077 | 1302 | 2.0E-11 |
| sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 984 | 1260 | 2.0E-11 |
| sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 1050 | 1284 | 2.0E-11 |
| sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 1117 | 1300 | 2.0E-11 |
| sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 1117 | 1300 | 2.0E-11 |
| sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 1117 | 1300 | 2.0E-11 |
| sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 1117 | 1300 | 2.0E-11 |
| sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 1117 | 1300 | 2.0E-11 |
| sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 1117 | 1300 | 2.0E-11 |
| sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 1117 | 1300 | 2.0E-11 |
| sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 1019 | 1306 | 2.0E-11 |
| sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 1040 | 1300 | 2.0E-11 |
| sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 1163 | 1300 | 3.0E-11 |
| sp|Q9I9H8|APAF_DANRE | Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 | 983 | 1302 | 3.0E-11 |
| sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 1129 | 1304 | 3.0E-11 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 1040 | 1197 | 3.0E-11 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 1040 | 1197 | 3.0E-11 |
| sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 1126 | 1300 | 4.0E-11 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 1127 | 1300 | 4.0E-11 |
| sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 989 | 1203 | 4.0E-11 |
| sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 1129 | 1301 | 4.0E-11 |
| sp|Q676U5|A16L1_HUMAN | Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 | 980 | 1185 | 4.0E-11 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 988 | 1300 | 4.0E-11 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 1037 | 1285 | 4.0E-11 |
| sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 1039 | 1301 | 4.0E-11 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 1039 | 1202 | 5.0E-11 |
| sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 980 | 1202 | 5.0E-11 |
| sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 987 | 1197 | 5.0E-11 |
| sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 1039 | 1301 | 5.0E-11 |
| sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 1160 | 1301 | 6.0E-11 |
| sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 982 | 1294 | 6.0E-11 |
| sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 1037 | 1202 | 6.0E-11 |
| sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 1037 | 1202 | 6.0E-11 |
| sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 1051 | 1260 | 6.0E-11 |
| sp|Q5I0B9|ATG16_XENTR | Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2 | 980 | 1185 | 6.0E-11 |
| sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 1027 | 1260 | 6.0E-11 |
| sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 1044 | 1306 | 6.0E-11 |
| sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 1039 | 1301 | 6.0E-11 |
| sp|Q8C7V3|UTP15_MOUSE | U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 | 1137 | 1300 | 6.0E-11 |
| sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 1064 | 1280 | 6.0E-11 |
| sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 1143 | 1304 | 7.0E-11 |
| sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 984 | 1260 | 7.0E-11 |
| sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 984 | 1260 | 7.0E-11 |
| sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 984 | 1260 | 7.0E-11 |
| sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 984 | 1260 | 7.0E-11 |
| sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 984 | 1260 | 7.0E-11 |
| sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 989 | 1203 | 7.0E-11 |
| sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 989 | 1203 | 7.0E-11 |
| sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 989 | 1203 | 7.0E-11 |
| sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 989 | 1203 | 7.0E-11 |
| sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 989 | 1203 | 7.0E-11 |
| sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 989 | 1203 | 7.0E-11 |
| sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 989 | 1203 | 7.0E-11 |
| sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 1044 | 1306 | 7.0E-11 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 996 | 1192 | 8.0E-11 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 1040 | 1264 | 8.0E-11 |
| sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 1039 | 1301 | 8.0E-11 |
| sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 983 | 1195 | 9.0E-11 |
| sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 989 | 1203 | 9.0E-11 |
| sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 1040 | 1202 | 9.0E-11 |
| sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 989 | 1198 | 9.0E-11 |
| sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 1129 | 1294 | 1.0E-10 |
| sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 1010 | 1192 | 1.0E-10 |
| sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 1142 | 1300 | 1.0E-10 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 989 | 1301 | 1.0E-10 |
| sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 1040 | 1202 | 1.0E-10 |
| sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 989 | 1199 | 1.0E-10 |
| sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 1039 | 1301 | 1.0E-10 |
| sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 1039 | 1301 | 1.0E-10 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 1160 | 1301 | 2.0E-10 |
| sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 1163 | 1300 | 2.0E-10 |
| sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 989 | 1197 | 2.0E-10 |
| sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 989 | 1202 | 2.0E-10 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 989 | 1301 | 2.0E-10 |
| sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 983 | 1195 | 2.0E-10 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 989 | 1301 | 2.0E-10 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 989 | 1301 | 2.0E-10 |
| sp|Q8C0J2|A16L1_MOUSE | Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 | 980 | 1185 | 2.0E-10 |
| sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 983 | 1195 | 2.0E-10 |
| sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 1074 | 1293 | 2.0E-10 |
| sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 992 | 1267 | 2.0E-10 |
| sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 1004 | 1197 | 2.0E-10 |
| sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 1044 | 1306 | 2.0E-10 |
| sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 1044 | 1306 | 2.0E-10 |
| sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 1044 | 1306 | 2.0E-10 |
| sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 994 | 1259 | 2.0E-10 |
| sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 989 | 1195 | 2.0E-10 |
| sp|A2RRU3|UTP15_RAT | U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 | 1137 | 1300 | 2.0E-10 |
| sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 1040 | 1300 | 2.0E-10 |
| sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 1108 | 1300 | 2.0E-10 |
| sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 1040 | 1206 | 3.0E-10 |
| sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 989 | 1197 | 3.0E-10 |
| sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 989 | 1197 | 3.0E-10 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 989 | 1197 | 3.0E-10 |
| sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 1049 | 1199 | 3.0E-10 |
| sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 989 | 1259 | 3.0E-10 |
| sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 1037 | 1196 | 3.0E-10 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 1163 | 1304 | 4.0E-10 |
| sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 1054 | 1300 | 4.0E-10 |
| sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 1160 | 1300 | 4.0E-10 |
| sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 989 | 1197 | 4.0E-10 |
| sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 1074 | 1300 | 4.0E-10 |
| sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 1072 | 1287 | 4.0E-10 |
| sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 1142 | 1304 | 4.0E-10 |
| sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 1129 | 1301 | 5.0E-10 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 1163 | 1304 | 5.0E-10 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 1163 | 1300 | 5.0E-10 |
| sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 1074 | 1300 | 5.0E-10 |
| sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 989 | 1197 | 5.0E-10 |
| sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 1039 | 1221 | 5.0E-10 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 1163 | 1300 | 6.0E-10 |
| sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 1040 | 1287 | 6.0E-10 |
| sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 1075 | 1292 | 7.0E-10 |
| sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 978 | 1195 | 7.0E-10 |
| sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 1096 | 1301 | 7.0E-10 |
| sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 1071 | 1300 | 8.0E-10 |
| sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 1071 | 1300 | 8.0E-10 |
| sp|Q5FVN8|WSDU1_RAT | WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 | 993 | 1198 | 9.0E-10 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 1040 | 1306 | 9.0E-10 |
| sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 982 | 1285 | 9.0E-10 |
| sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 1159 | 1301 | 1.0E-09 |
| sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 1159 | 1301 | 1.0E-09 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 989 | 1197 | 1.0E-09 |
| sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 989 | 1202 | 1.0E-09 |
| sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 978 | 1195 | 1.0E-09 |
| sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 1064 | 1280 | 1.0E-09 |
| sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 1064 | 1280 | 1.0E-09 |
| sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 1043 | 1199 | 1.0E-09 |
| sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 984 | 1202 | 1.0E-09 |
| sp|Q9W5Z5|WSB1_TAKRU | WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 | 983 | 1196 | 1.0E-09 |
| sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 1160 | 1301 | 2.0E-09 |
| sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 1160 | 1301 | 2.0E-09 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 989 | 1196 | 2.0E-09 |
| sp|Q15269|PWP2_HUMAN | Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 | 1034 | 1300 | 2.0E-09 |
| sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 983 | 1195 | 2.0E-09 |
| sp|Q5RAC9|A16L1_PONAB | Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 | 980 | 1185 | 2.0E-09 |
| sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 1074 | 1300 | 2.0E-09 |
| sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 1074 | 1300 | 2.0E-09 |
| sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 989 | 1195 | 2.0E-09 |
| sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 1077 | 1294 | 2.0E-09 |
| sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 1040 | 1300 | 2.0E-09 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 983 | 1107 | 3.0E-09 |
| sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 1129 | 1300 | 3.0E-09 |
| sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 1072 | 1293 | 3.0E-09 |
| sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 1129 | 1301 | 3.0E-09 |
| sp|Q5RFQ3|PWP2_PONAB | Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 | 1034 | 1300 | 3.0E-09 |
| sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 974 | 1260 | 3.0E-09 |
| sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 1074 | 1300 | 3.0E-09 |
| sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 1045 | 1197 | 3.0E-09 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 996 | 1200 | 3.0E-09 |
| sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 1135 | 1304 | 3.0E-09 |
| sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 978 | 1195 | 4.0E-09 |
| sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 989 | 1157 | 4.0E-09 |
| sp|A7MB12|UTP15_BOVIN | U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 | 1137 | 1300 | 4.0E-09 |
| sp|Q8TED0|UTP15_HUMAN | U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 | 1137 | 1300 | 4.0E-09 |
| sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 1164 | 1300 | 4.0E-09 |
| sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 1040 | 1300 | 4.0E-09 |
| sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 1037 | 1261 | 4.0E-09 |
| sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 1159 | 1301 | 5.0E-09 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1091 | 1300 | 5.0E-09 |
| sp|Q5H7C0|CDC20_PIG | Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 | 989 | 1153 | 5.0E-09 |
| sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 1074 | 1300 | 5.0E-09 |
| sp|Q8N9V3|WSDU1_HUMAN | WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 | 996 | 1220 | 5.0E-09 |
| sp|Q7ZXZ2|UTP15_XENLA | U3 small nucleolar RNA-associated protein 15 homolog OS=Xenopus laevis GN=utp15 PE=2 SV=1 | 1137 | 1300 | 5.0E-09 |
| sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 958 | 1301 | 6.0E-09 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 1163 | 1300 | 6.0E-09 |
| sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 1126 | 1304 | 6.0E-09 |
| sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 987 | 1195 | 6.0E-09 |
| sp|B3MJV8|WDR12_DROAN | Ribosome biogenesis protein WDR12 homolog OS=Drosophila ananassae GN=GF14067 PE=3 SV=1 | 1002 | 1269 | 6.0E-09 |
| sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 967 | 1192 | 7.0E-09 |
| sp|P91341|PWP2_CAEEL | Periodic tryptophan protein 2 homolog OS=Caenorhabditis elegans GN=F55F8.3 PE=3 SV=2 | 1129 | 1301 | 7.0E-09 |
| sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 1074 | 1300 | 7.0E-09 |
| sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 1040 | 1304 | 7.0E-09 |
| sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 1039 | 1215 | 7.0E-09 |
| sp|B4LS78|WDR12_DROVI | Ribosome biogenesis protein WDR12 homolog OS=Drosophila virilis GN=GJ17641 PE=3 SV=1 | 1001 | 1269 | 7.0E-09 |
| sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 989 | 1178 | 8.0E-09 |
| sp|Q62623|CDC20_RAT | Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 | 989 | 1153 | 9.0E-09 |
| sp|Q12834|CDC20_HUMAN | Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 | 989 | 1153 | 9.0E-09 |
| sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 1160 | 1301 | 1.0E-08 |
| sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 980 | 1176 | 1.0E-08 |
| sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 1001 | 1195 | 1.0E-08 |
| sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 1120 | 1304 | 1.0E-08 |
| sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 989 | 1197 | 1.0E-08 |
| sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 1040 | 1198 | 1.0E-08 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 996 | 1198 | 1.0E-08 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 1129 | 1301 | 1.0E-08 |
| sp|Q5XGE2|UTP15_XENTR | U3 small nucleolar RNA-associated protein 15 homolog OS=Xenopus tropicalis GN=utp15 PE=2 SV=1 | 1137 | 1300 | 1.0E-08 |
| sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 1039 | 1196 | 1.0E-08 |
| sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 1159 | 1300 | 2.0E-08 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1091 | 1300 | 2.0E-08 |
| sp|Q9I9H8|APAF_DANRE | Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 | 970 | 1305 | 2.0E-08 |
| sp|Q5XGE2|UTP15_XENTR | U3 small nucleolar RNA-associated protein 15 homolog OS=Xenopus tropicalis GN=utp15 PE=2 SV=1 | 995 | 1192 | 2.0E-08 |
| sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 977 | 1300 | 2.0E-08 |
| sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 1124 | 1305 | 3.0E-08 |
| sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 1124 | 1305 | 3.0E-08 |
| sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 1120 | 1304 | 3.0E-08 |
| sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 1120 | 1301 | 3.0E-08 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 883 | 1155 | 3.0E-08 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 1002 | 1199 | 3.0E-08 |
| sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 1060 | 1263 | 3.0E-08 |
| sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 1071 | 1263 | 4.0E-08 |
| sp|Q9D0I6|WSDU1_MOUSE | WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 | 993 | 1198 | 4.0E-08 |
| sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 1082 | 1300 | 4.0E-08 |
| sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 987 | 1195 | 4.0E-08 |
| sp|P38123|SWD3_YEAST | COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1 | 1040 | 1266 | 4.0E-08 |
| sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 1002 | 1199 | 4.0E-08 |
| sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 1040 | 1196 | 4.0E-08 |
| sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 1160 | 1301 | 5.0E-08 |
| sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 1074 | 1300 | 5.0E-08 |
| sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 1064 | 1300 | 5.0E-08 |
| sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 1019 | 1284 | 5.0E-08 |
| sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 1159 | 1301 | 6.0E-08 |
| sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 993 | 1094 | 6.0E-08 |
| sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 993 | 1094 | 6.0E-08 |
| sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 993 | 1094 | 6.0E-08 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 1002 | 1199 | 6.0E-08 |
| sp|Q8C7V3|UTP15_MOUSE | U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 | 995 | 1250 | 6.0E-08 |
| sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 993 | 1094 | 7.0E-08 |
| sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 1064 | 1300 | 7.0E-08 |
| sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 987 | 1195 | 7.0E-08 |
| sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 987 | 1195 | 7.0E-08 |
| sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 987 | 1195 | 7.0E-08 |
| sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 987 | 1195 | 7.0E-08 |
| sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 987 | 1195 | 7.0E-08 |
| sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 1137 | 1301 | 8.0E-08 |
| sp|Q9JJ66|CDC20_MOUSE | Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 | 989 | 1153 | 8.0E-08 |
| sp|P93563|GBB_SOLTU | Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1 | 1001 | 1195 | 8.0E-08 |
| sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 1222 | 1304 | 9.0E-08 |
| sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 1139 | 1294 | 9.0E-08 |
| sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 1163 | 1304 | 1.0E-07 |
| sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 1147 | 1304 | 1.0E-07 |
| sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 1222 | 1306 | 1.0E-07 |
| sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 993 | 1094 | 1.0E-07 |
| sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 1121 | 1304 | 1.0E-07 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 990 | 1303 | 1.0E-07 |
| sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 1129 | 1304 | 1.0E-07 |
| sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 1129 | 1304 | 1.0E-07 |
| sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 1000 | 1195 | 1.0E-07 |
| sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 1060 | 1263 | 1.0E-07 |
| sp|Q8TED0|UTP15_HUMAN | U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3 | 995 | 1250 | 1.0E-07 |
| sp|Q6NNP0|ATG16_ARATH | Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 | 1109 | 1293 | 1.0E-07 |
| sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 1040 | 1198 | 1.0E-07 |
| sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 989 | 1097 | 2.0E-07 |
| sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 1161 | 1301 | 2.0E-07 |
| sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 1077 | 1300 | 2.0E-07 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 1124 | 1304 | 2.0E-07 |
| sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 1222 | 1304 | 2.0E-07 |
| sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 1222 | 1304 | 2.0E-07 |
| sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 1128 | 1300 | 2.0E-07 |
| sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 983 | 1176 | 2.0E-07 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 1023 | 1300 | 2.0E-07 |
| sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 1129 | 1300 | 2.0E-07 |
| sp|O43071|PRP17_SCHPO | Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 | 960 | 1196 | 2.0E-07 |
| sp|A2RRU3|UTP15_RAT | U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 | 995 | 1250 | 2.0E-07 |
| sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 1040 | 1205 | 2.0E-07 |
| sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 1167 | 1304 | 3.0E-07 |
| sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 1045 | 1262 | 3.0E-07 |
| sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 1160 | 1301 | 3.0E-07 |
| sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 3.0E-07 |
| sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 3.0E-07 |
| sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 1137 | 1304 | 3.0E-07 |
| sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 982 | 1196 | 3.0E-07 |
| sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 1120 | 1304 | 3.0E-07 |
| sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 1060 | 1263 | 3.0E-07 |
| sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 1064 | 1300 | 3.0E-07 |
| sp|Q8CGF6|WDR47_MOUSE | WD repeat-containing protein 47 OS=Mus musculus GN=Wdr47 PE=1 SV=2 | 1040 | 1303 | 3.0E-07 |
| sp|Q9Z1Z2|STRAP_MOUSE | Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 | 1029 | 1259 | 3.0E-07 |
| sp|A7THX0|MDV1_VANPO | Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 | 1136 | 1304 | 3.0E-07 |
| sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 989 | 1197 | 4.0E-07 |
| sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 1081 | 1303 | 5.0E-07 |
| sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 1129 | 1300 | 5.0E-07 |
| sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 1064 | 1300 | 5.0E-07 |
| sp|Q10282|GBB_SCHPO | Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 | 1129 | 1300 | 5.0E-07 |
| sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 987 | 1195 | 5.0E-07 |
| sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 1041 | 1285 | 5.0E-07 |
| sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 1160 | 1300 | 6.0E-07 |
| sp|A7MB12|UTP15_BOVIN | U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 | 995 | 1250 | 6.0E-07 |
| sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 1043 | 1305 | 6.0E-07 |
| sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 1161 | 1300 | 7.0E-07 |
| sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 1164 | 1300 | 7.0E-07 |
| sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 1082 | 1300 | 7.0E-07 |
| sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 1082 | 1300 | 7.0E-07 |
| sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 987 | 1195 | 7.0E-07 |
| sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 1159 | 1300 | 7.0E-07 |
| sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 1222 | 1304 | 8.0E-07 |
| sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 989 | 1096 | 8.0E-07 |
| sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 8.0E-07 |
| sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 8.0E-07 |
| sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 1129 | 1300 | 8.0E-07 |
| sp|B3MJV8|WDR12_DROAN | Ribosome biogenesis protein WDR12 homolog OS=Drosophila ananassae GN=GF14067 PE=3 SV=1 | 1133 | 1303 | 8.0E-07 |
| sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 989 | 1196 | 9.0E-07 |
| sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 9.0E-07 |
| sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 9.0E-07 |
| sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 1163 | 1304 | 9.0E-07 |
| sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 1000 | 1089 | 9.0E-07 |
| sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 9.0E-07 |
| sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 1129 | 1300 | 9.0E-07 |
| sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 1163 | 1300 | 1.0E-06 |
| sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 1164 | 1300 | 1.0E-06 |
| sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 1.0E-06 |
| sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 1.0E-06 |
| sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 1.0E-06 |
| sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 1155 | 1300 | 1.0E-06 |
| sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 1159 | 1300 | 1.0E-06 |
| sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 987 | 1195 | 1.0E-06 |
| sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 1163 | 1300 | 2.0E-06 |
| sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 1163 | 1304 | 2.0E-06 |
| sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 1163 | 1300 | 2.0E-06 |
| sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 1163 | 1300 | 2.0E-06 |
| sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 1163 | 1300 | 2.0E-06 |
| sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 1163 | 1300 | 2.0E-06 |
| sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 1163 | 1300 | 2.0E-06 |
| sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 1163 | 1304 | 2.0E-06 |
| sp|Q9I9H8|APAF_DANRE | Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 | 1040 | 1197 | 2.0E-06 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 1000 | 1089 | 2.0E-06 |
| sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 1163 | 1304 | 2.0E-06 |
| sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 1122 | 1304 | 2.0E-06 |
| sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 1164 | 1304 | 2.0E-06 |
| sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 985 | 1196 | 2.0E-06 |
| sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 1045 | 1197 | 2.0E-06 |
| sp|Q758R7|MDV1_ASHGO | Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 | 1136 | 1304 | 2.0E-06 |
| sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 1096 | 1301 | 2.0E-06 |
| sp|Q9LJR3|SPA3_ARATH | Protein SPA1-RELATED 3 OS=Arabidopsis thaliana GN=SPA3 PE=1 SV=1 | 1142 | 1303 | 2.0E-06 |
| sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 1034 | 1259 | 2.0E-06 |
| sp|O94967|WDR47_HUMAN | WD repeat-containing protein 47 OS=Homo sapiens GN=WDR47 PE=1 SV=1 | 1040 | 1303 | 2.0E-06 |
| sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 1163 | 1300 | 3.0E-06 |
| sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 1163 | 1300 | 3.0E-06 |
| sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 1163 | 1300 | 3.0E-06 |
| sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 1163 | 1300 | 3.0E-06 |
| sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 1139 | 1294 | 3.0E-06 |
| sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 1164 | 1300 | 3.0E-06 |
| sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 1160 | 1300 | 3.0E-06 |
| sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 1164 | 1300 | 3.0E-06 |
| sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 1160 | 1300 | 3.0E-06 |
| sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 1160 | 1300 | 3.0E-06 |
| sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 1070 | 1285 | 3.0E-06 |
| sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 1160 | 1300 | 3.0E-06 |
| sp|O43071|PRP17_SCHPO | Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 | 1128 | 1304 | 3.0E-06 |
| sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 1159 | 1300 | 3.0E-06 |
| sp|P87177|YB1C_SCHPO | Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 | 1016 | 1238 | 4.0E-06 |
| sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 1163 | 1304 | 4.0E-06 |
| sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 1163 | 1300 | 4.0E-06 |
| sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 1159 | 1301 | 4.0E-06 |
| sp|O02482|UNC37_CAEEL | Transcription factor unc-37 OS=Caenorhabditis elegans GN=unc-37 PE=1 SV=1 | 981 | 1195 | 4.0E-06 |
| sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 1167 | 1300 | 5.0E-06 |
| sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 1163 | 1300 | 5.0E-06 |
| sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 970 | 1154 | 5.0E-06 |
| sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 982 | 1154 | 5.0E-06 |
| sp|P93339|GBB_NICPL | Guanine nucleotide-binding protein subunit beta OS=Nicotiana plumbaginifolia PE=2 SV=1 | 1004 | 1153 | 5.0E-06 |
| sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 1160 | 1300 | 6.0E-06 |
| sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 1216 | 1300 | 6.0E-06 |
| sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 999 | 1108 | 6.0E-06 |
| sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 1005 | 1198 | 6.0E-06 |
| sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 989 | 1191 | 6.0E-06 |
| sp|Q8BU03|PWP2_MOUSE | Periodic tryptophan protein 2 homolog OS=Mus musculus GN=Pwp2 PE=1 SV=1 | 1034 | 1300 | 6.0E-06 |
| sp|Q758R7|MDV1_ASHGO | Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 | 1143 | 1300 | 6.0E-06 |
| sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 989 | 1259 | 6.0E-06 |
| sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 1042 | 1260 | 7.0E-06 |
| sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 1043 | 1262 | 7.0E-06 |
| sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 1070 | 1285 | 7.0E-06 |
| sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 1138 | 1304 | 7.0E-06 |
| sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 1161 | 1293 | 8.0E-06 |
| sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 987 | 1097 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005515 | protein binding | Yes |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|696450 MSEKPSPSRTDRISSRASRLKNRISSTSPRTPSLRRLPSRQHPALLEDDTGRLDVLTELPEIPLSLAFASCQPAS AISARSGANSLSVQLPNSQPLQPPASIQDLEGSANQYPSLVPEPMQLAPAASQLLQGQAVVLSHSGQAPQGHYDQ GRGMFYRSHDFSIVNSTFVDISAASDTFMKELLQETIPGAEFDSSDRYPPPRCHPGTRLAIIQRCLDFIAQCSDK EKMRWIVGHAGVGKSAIMQIVAENAPGVIVASVFFCADERKDGSKTFTTIAYQLAVKCEPYRAFIRNEITRDPAL FRRALPTQFNKFIVEPFIRHLVNYPHRFVILIDGLDECSNPLTQRELLELISGFCIQYPTSPVAWIVASRPEPII TLFFDKPEVAPAYTKEDVAVDSDEGRQDVELYLSDELAKIKRNNTTLQHEAEWPSKHGLLKITTASGGLFAYASI VVKYIDDPYYGDPASQFFDVLVVIDAGPKRDRLGRDHPLAPLDALYERILSKIPHDVMVNTRRLLLPQRYWRWGA NKFRLQCNLMGLTQHAAYGAVRHICSVVKVPIPNEADKKSFKFFHKSFDDYLGDFERSGFSPDMQQEANELMAQI SLRVAEEVLDDSGDEDGGEVIECRDYGYLKVGPGTGCDNITLSWPGDERFERTNDEVKVELYSSAITAISDRFAH RHKAFLNTSCFRVLTRCFTAPRIYFPFYKLLDFAFDDFRNELVELGVLKQVSLKTLDYAAICGRIELQFMSPIVT NVRISNPWNPVCKHKSADVHDLGGWRWCGSKTTFGRYAEDVDSSQGPEVDLIDIPRSSIVEGNKSHWGCLSETRW NVENCHFCLGRLFRLFIDSPDLPATVFFDSTGLCYVELAFVDPDDGVSQWRYRFLHSGLPSGHADSVTSTPTVIE HIKTVQYANIKMHLFSLARRSGSSSGHFTTGPGVGAIGPPASANQGFPDDLDIHTVAPDFKKEGTDWFAIFNPKV KRQLDVSLVHTLMHDSVVCCVRFSADGKYLATGCNRTAQIYDTKAGQKTCVLVDEAAEKAGDLYIRSVCFSPDGK FLATGAEDKQIRIWDIGKKRIRNVFDGHQQEIYSLDFSPDGRHLVSGSNGCIGIWDMVDGTSKFLTIEDPGPLHR NAGITSVAISPNGKFAAAGSLDTVVRIWNIRSGVLVESLKGHSDSVYSVAFTPDGKGLVSGSLDKTLKYWDVEAL GRRWRRRPVMKGNYEAGYDEGNRCTMNFTGHKDYVLSVAVSHDGQWVVSGSKDRGVQFWDAKNAVVQCMLQGHKN SINSIDLSPAGSLATGSGDWQARIWSYSSVL* |
| Coding | >Agabi119p4|696450 ATGTCAGAAAAACCTTCGCCGAGTCGTACGGATCGTATCTCGTCTCGGGCTTCTCGCCTCAAGAATCGTATTTCT TCCACCTCCCCTCGTACGCCGTCTCTGCGCCGTTTGCCTTCCCGCCAGCATCCTGCTTTGCTTGAGGATGACACA GGAAGATTGGACGTGCTAACTGAACTTCCGGAAATCCCACTCTCTCTAGCATTCGCCTCTTGTCAACCAGCATCG GCCATTTCCGCCCGTTCCGGCGCCAATTCCCTATCCGTTCAACTGCCGAATTCCCAACCCCTACAGCCTCCCGCT AGTATTCAAGACTTGGAAGGCTCGGCTAACCAATACCCTTCTTTGGTCCCAGAACCCATGCAGCTTGCCCCTGCT GCATCCCAGCTTCTTCAAGGTCAAGCAGTCGTGCTGTCTCATTCTGGCCAGGCTCCTCAAGGGCATTATGACCAA GGCCGAGGCATGTTCTATAGATCGCATGATTTTTCTATCGTGAATAGTACATTTGTTGACATCAGCGCCGCCTCG GACACCTTCATGAAGGAGCTTCTCCAGGAGACGATACCTGGAGCTGAGTTCGACTCTTCCGACCGTTATCCACCC CCGCGATGTCACCCCGGAACCCGGCTGGCGATCATACAACGGTGCTTGGATTTCATTGCCCAGTGTAGCGACAAA GAAAAGATGCGTTGGATAGTCGGCCACGCTGGAGTTGGAAAGTCGGCAATAATGCAGATCGTTGCTGAAAATGCT CCTGGTGTCATCGTTGCTTCAGTTTTTTTTTGCGCGGACGAACGTAAAGATGGATCTAAAACTTTCACGACTATT GCGTATCAACTCGCTGTCAAGTGCGAGCCCTATCGTGCATTCATCCGGAACGAGATCACCAGAGATCCAGCTCTC TTTCGAAGAGCGCTACCAACCCAGTTCAACAAGTTCATTGTTGAACCATTCATCCGTCACTTAGTCAATTATCCG CATCGATTCGTCATTCTCATTGATGGCCTTGACGAATGCAGCAATCCTCTCACACAACGAGAGCTGCTCGAGCTA ATCTCGGGCTTTTGCATCCAATATCCTACGTCGCCGGTCGCATGGATTGTTGCCAGTCGCCCAGAGCCCATCATC ACTCTGTTCTTTGACAAGCCCGAGGTTGCGCCAGCATATACAAAGGAGGACGTTGCAGTAGATTCAGATGAAGGG CGTCAAGATGTCGAATTATATCTCAGTGATGAACTAGCAAAGATCAAACGCAACAACACTACGTTGCAGCATGAG GCAGAGTGGCCCTCCAAGCATGGCTTACTGAAGATCACTACAGCCTCGGGAGGGCTATTCGCGTATGCTTCAATA GTAGTCAAATATATCGACGACCCATACTACGGAGATCCAGCCTCTCAGTTTTTTGACGTCCTCGTGGTCATTGAT GCGGGTCCGAAACGTGATAGACTGGGAAGAGATCATCCTCTGGCTCCGCTCGATGCGTTGTATGAGAGGATTCTC TCCAAGATTCCACATGATGTGATGGTTAACACCAGGAGGCTACTACTCCCGCAACGGTATTGGCGTTGGGGTGCG AATAAATTTCGTTTACAATGCAATCTCATGGGATTGACTCAGCACGCTGCTTATGGCGCCGTTCGTCATATATGC TCCGTCGTGAAGGTTCCTATTCCTAACGAAGCTGACAAGAAATCCTTCAAGTTTTTCCACAAATCGTTTGATGAC TATCTAGGCGACTTCGAACGATCCGGATTTTCCCCCGACATGCAGCAGGAAGCTAATGAGCTCATGGCTCAGATT TCATTGCGGGTAGCCGAGGAGGTTCTCGATGACTCCGGAGATGAGGATGGTGGTGAAGTCATCGAGTGTCGGGAC TATGGGTATTTGAAAGTTGGACCTGGCACCGGTTGTGACAACATTACCCTTTCTTGGCCTGGTGATGAGCGCTTC GAAAGGACCAACGACGAAGTCAAGGTCGAGTTGTACAGTAGTGCAATTACCGCCATTTCGGACCGATTTGCTCAT CGCCACAAAGCCTTTTTGAATACATCCTGCTTCCGTGTGTTGACCAGGTGTTTCACTGCGCCTCGCATCTATTTT CCGTTTTACAAATTGCTAGATTTTGCTTTCGACGATTTCCGGAATGAGCTTGTCGAGCTTGGCGTTCTGAAGCAA GTGTCTCTTAAGACATTAGATTATGCAGCAATCTGCGGACGAATAGAACTGCAATTTATGAGCCCCATCGTGACA AATGTCAGAATATCTAATCCATGGAATCCTGTTTGCAAACATAAATCAGCTGACGTGCATGATTTGGGAGGGTGG CGGTGGTGTGGCTCGAAAACCACGTTTGGCAGATACGCAGAAGACGTGGATTCGAGCCAGGGTCCCGAGGTTGAC CTCATAGACATTCCTCGGTCGAGTATTGTTGAAGGCAACAAATCTCACTGGGGATGCCTCTCAGAAACACGTTGG AACGTTGAAAATTGCCATTTCTGCTTGGGGCGTCTTTTCCGTCTTTTTATTGACAGTCCAGATCTACCAGCTACT GTGTTCTTTGACTCGACTGGATTATGTTATGTGGAGTTGGCGTTTGTTGACCCGGATGATGGGGTGTCGCAGTGG AGGTACCGATTTTTACATTCGGGTCTTCCGTCTGGTCATGCGGATTCTGTTACCTCGACGCCAACAGTTATCGAA CATATAAAAACTGTCCAATATGCAAACATTAAAATGCATTTGTTCAGTTTAGCTCGTCGCTCTGGTTCATCTTCA GGTCACTTCACAACGGGCCCAGGTGTCGGAGCCATTGGCCCTCCTGCGAGTGCCAATCAAGGTTTCCCGGATGAT CTTGACATACACACCGTGGCACCTGACTTCAAAAAGGAAGGAACAGATTGGTTCGCGATCTTCAACCCTAAAGTC AAAAGGCAACTTGATGTCTCCTTGGTGCACACTCTGATGCACGATAGTGTTGTTTGCTGCGTCAGATTCTCGGCT GATGGCAAATATCTCGCGACGGGATGTAACCGAACGGCTCAAATCTACGATACTAAGGCGGGTCAGAAGACATGT GTTCTGGTCGACGAAGCTGCCGAGAAAGCTGGAGATCTCTACATTCGAAGCGTGTGTTTCAGTCCTGACGGCAAG TTCCTTGCAACGGGAGCAGAGGATAAACAAATCCGTATCTGGGATATTGGCAAGAAACGGATTCGCAACGTATTC GATGGTCACCAACAAGAAATATACTCATTGGACTTTTCACCTGACGGTCGTCATCTTGTTTCCGGGTCCAATGGA TGTATCGGGATTTGGGATATGGTTGATGGAACTTCAAAGTTTTTGACTATCGAAGATCCTGGTCCTCTACATCGC AACGCAGGCATTACATCAGTGGCTATCAGTCCGAATGGAAAATTTGCCGCCGCTGGAAGTCTGGACACTGTCGTG CGGATCTGGAATATACGTAGTGGAGTGTTAGTGGAAAGCCTGAAAGGGCATAGTGATAGCGTTTACAGTGTCGCT TTCACGCCTGATGGGAAGGGACTTGTGAGTGGGAGTCTGGATAAGACGTTGAAGTATTGGGATGTTGAGGCCCTT GGTCGTAGGTGGAGACGACGGCCTGTGATGAAGGGTAATTATGAGGCGGGATATGATGAAGGAAATCGTTGTACC ATGAATTTCACTGGGCACAAGGATTACGTATTGAGTGTGGCAGTTTCGCACGATGGACAATGGGTCGTTTCAGGT TCCAAAGATCGTGGTGTGCAGTTTTGGGATGCGAAGAATGCGGTTGTGCAGTGTATGCTTCAAGGTCACAAGAAT TCCATTAATTCAATCGATTTGAGCCCAGCGGGAAGCTTGGCAACTGGAAGTGGGGATTGGCAAGCTAGAATTTGG AGCTATAGTTCAGTACTATAA |
| Transcript | >Agabi119p4|696450 ATGTCAGAAAAACCTTCGCCGAGTCGTACGGATCGTATCTCGTCTCGGGCTTCTCGCCTCAAGAATCGTATTTCT TCCACCTCCCCTCGTACGCCGTCTCTGCGCCGTTTGCCTTCCCGCCAGCATCCTGCTTTGCTTGAGGATGACACA GGAAGATTGGACGTGCTAACTGAACTTCCGGAAATCCCACTCTCTCTAGCATTCGCCTCTTGTCAACCAGCATCG GCCATTTCCGCCCGTTCCGGCGCCAATTCCCTATCCGTTCAACTGCCGAATTCCCAACCCCTACAGCCTCCCGCT AGTATTCAAGACTTGGAAGGCTCGGCTAACCAATACCCTTCTTTGGTCCCAGAACCCATGCAGCTTGCCCCTGCT GCATCCCAGCTTCTTCAAGGTCAAGCAGTCGTGCTGTCTCATTCTGGCCAGGCTCCTCAAGGGCATTATGACCAA GGCCGAGGCATGTTCTATAGATCGCATGATTTTTCTATCGTGAATAGTACATTTGTTGACATCAGCGCCGCCTCG GACACCTTCATGAAGGAGCTTCTCCAGGAGACGATACCTGGAGCTGAGTTCGACTCTTCCGACCGTTATCCACCC CCGCGATGTCACCCCGGAACCCGGCTGGCGATCATACAACGGTGCTTGGATTTCATTGCCCAGTGTAGCGACAAA GAAAAGATGCGTTGGATAGTCGGCCACGCTGGAGTTGGAAAGTCGGCAATAATGCAGATCGTTGCTGAAAATGCT CCTGGTGTCATCGTTGCTTCAGTTTTTTTTTGCGCGGACGAACGTAAAGATGGATCTAAAACTTTCACGACTATT GCGTATCAACTCGCTGTCAAGTGCGAGCCCTATCGTGCATTCATCCGGAACGAGATCACCAGAGATCCAGCTCTC TTTCGAAGAGCGCTACCAACCCAGTTCAACAAGTTCATTGTTGAACCATTCATCCGTCACTTAGTCAATTATCCG CATCGATTCGTCATTCTCATTGATGGCCTTGACGAATGCAGCAATCCTCTCACACAACGAGAGCTGCTCGAGCTA ATCTCGGGCTTTTGCATCCAATATCCTACGTCGCCGGTCGCATGGATTGTTGCCAGTCGCCCAGAGCCCATCATC ACTCTGTTCTTTGACAAGCCCGAGGTTGCGCCAGCATATACAAAGGAGGACGTTGCAGTAGATTCAGATGAAGGG CGTCAAGATGTCGAATTATATCTCAGTGATGAACTAGCAAAGATCAAACGCAACAACACTACGTTGCAGCATGAG GCAGAGTGGCCCTCCAAGCATGGCTTACTGAAGATCACTACAGCCTCGGGAGGGCTATTCGCGTATGCTTCAATA GTAGTCAAATATATCGACGACCCATACTACGGAGATCCAGCCTCTCAGTTTTTTGACGTCCTCGTGGTCATTGAT GCGGGTCCGAAACGTGATAGACTGGGAAGAGATCATCCTCTGGCTCCGCTCGATGCGTTGTATGAGAGGATTCTC TCCAAGATTCCACATGATGTGATGGTTAACACCAGGAGGCTACTACTCCCGCAACGGTATTGGCGTTGGGGTGCG AATAAATTTCGTTTACAATGCAATCTCATGGGATTGACTCAGCACGCTGCTTATGGCGCCGTTCGTCATATATGC TCCGTCGTGAAGGTTCCTATTCCTAACGAAGCTGACAAGAAATCCTTCAAGTTTTTCCACAAATCGTTTGATGAC TATCTAGGCGACTTCGAACGATCCGGATTTTCCCCCGACATGCAGCAGGAAGCTAATGAGCTCATGGCTCAGATT TCATTGCGGGTAGCCGAGGAGGTTCTCGATGACTCCGGAGATGAGGATGGTGGTGAAGTCATCGAGTGTCGGGAC TATGGGTATTTGAAAGTTGGACCTGGCACCGGTTGTGACAACATTACCCTTTCTTGGCCTGGTGATGAGCGCTTC GAAAGGACCAACGACGAAGTCAAGGTCGAGTTGTACAGTAGTGCAATTACCGCCATTTCGGACCGATTTGCTCAT CGCCACAAAGCCTTTTTGAATACATCCTGCTTCCGTGTGTTGACCAGGTGTTTCACTGCGCCTCGCATCTATTTT CCGTTTTACAAATTGCTAGATTTTGCTTTCGACGATTTCCGGAATGAGCTTGTCGAGCTTGGCGTTCTGAAGCAA GTGTCTCTTAAGACATTAGATTATGCAGCAATCTGCGGACGAATAGAACTGCAATTTATGAGCCCCATCGTGACA AATGTCAGAATATCTAATCCATGGAATCCTGTTTGCAAACATAAATCAGCTGACGTGCATGATTTGGGAGGGTGG CGGTGGTGTGGCTCGAAAACCACGTTTGGCAGATACGCAGAAGACGTGGATTCGAGCCAGGGTCCCGAGGTTGAC CTCATAGACATTCCTCGGTCGAGTATTGTTGAAGGCAACAAATCTCACTGGGGATGCCTCTCAGAAACACGTTGG AACGTTGAAAATTGCCATTTCTGCTTGGGGCGTCTTTTCCGTCTTTTTATTGACAGTCCAGATCTACCAGCTACT GTGTTCTTTGACTCGACTGGATTATGTTATGTGGAGTTGGCGTTTGTTGACCCGGATGATGGGGTGTCGCAGTGG AGGTACCGATTTTTACATTCGGGTCTTCCGTCTGGTCATGCGGATTCTGTTACCTCGACGCCAACAGTTATCGAA CATATAAAAACTGTCCAATATGCAAACATTAAAATGCATTTGTTCAGTTTAGCTCGTCGCTCTGGTTCATCTTCA GGTCACTTCACAACGGGCCCAGGTGTCGGAGCCATTGGCCCTCCTGCGAGTGCCAATCAAGGTTTCCCGGATGAT CTTGACATACACACCGTGGCACCTGACTTCAAAAAGGAAGGAACAGATTGGTTCGCGATCTTCAACCCTAAAGTC AAAAGGCAACTTGATGTCTCCTTGGTGCACACTCTGATGCACGATAGTGTTGTTTGCTGCGTCAGATTCTCGGCT GATGGCAAATATCTCGCGACGGGATGTAACCGAACGGCTCAAATCTACGATACTAAGGCGGGTCAGAAGACATGT GTTCTGGTCGACGAAGCTGCCGAGAAAGCTGGAGATCTCTACATTCGAAGCGTGTGTTTCAGTCCTGACGGCAAG TTCCTTGCAACGGGAGCAGAGGATAAACAAATCCGTATCTGGGATATTGGCAAGAAACGGATTCGCAACGTATTC GATGGTCACCAACAAGAAATATACTCATTGGACTTTTCACCTGACGGTCGTCATCTTGTTTCCGGGTCCAATGGA TGTATCGGGATTTGGGATATGGTTGATGGAACTTCAAAGTTTTTGACTATCGAAGATCCTGGTCCTCTACATCGC AACGCAGGCATTACATCAGTGGCTATCAGTCCGAATGGAAAATTTGCCGCCGCTGGAAGTCTGGACACTGTCGTG CGGATCTGGAATATACGTAGTGGAGTGTTAGTGGAAAGCCTGAAAGGGCATAGTGATAGCGTTTACAGTGTCGCT TTCACGCCTGATGGGAAGGGACTTGTGAGTGGGAGTCTGGATAAGACGTTGAAGTATTGGGATGTTGAGGCCCTT GGTCGTAGGTGGAGACGACGGCCTGTGATGAAGGGTAATTATGAGGCGGGATATGATGAAGGAAATCGTTGTACC ATGAATTTCACTGGGCACAAGGATTACGTATTGAGTGTGGCAGTTTCGCACGATGGACAATGGGTCGTTTCAGGT TCCAAAGATCGTGGTGTGCAGTTTTGGGATGCGAAGAATGCGGTTGTGCAGTGTATGCTTCAAGGTCACAAGAAT TCCATTAATTCAATCGATTTGAGCCCAGCGGGAAGCTTGGCAACTGGAAGTGGGGATTGGCAAGCTAGAATTTGG AGCTATAGTTCAGTACTATAA |
| Gene | >Agabi119p4|696450 ATGTCAGAAAAACCTTCGCCGAGTCGTACGGATCGTATCTCGTCTCGGGCTTCTCGCCTCAAGAATCGTATTTCT TCCACCTCCCCTCGTACGCCGTCTCTGCGCCGTTTGCCTTCCCGCCAGCATCCTGCTTTGCTTGAGGATGACACA GGAAGATTGGACGTGCTAACTGAACTTCCGGAAATCCCACTCTCTCTAGCATTCGCCTCTTGTCAACCAGCATCG GCCATTTCCGCCCGTTCCGGCGCCAATTCCCTATCCGTTCAACTGCCGAATTCCCAACCCCTACAGCCTCCCGCT AGTATTCAAGACTTGGAAGGCTCGGCTAACCAATACCCTTCTTTGGTCCCAGAACCCATGCAGCTTGCCCCTGCT GCATCCCAGCTTCTTCAAGGTCAAGCAGTCGTGCTGTCTCATTCTGGCCAGGCTCCTCAAGGGCATTATGTGGGT GTTCTTCTCCAGCTCTGATATGTCGAGTGGCAATTTACCTTCGCATCAACAGGACCAAGGCCGAGGCATGTTCTA TAGATCGCATGATTTTTCTATCGTGAATAGTACATTTGTTGACATCAGCGCCGCCTCGGACACCTGTGAGAAATG CTCCCGTCGTATATCTAGTGCACTTATGCTTACTGTTTTAACTCCATCAGTCATGAAGGAGCTTCTCCAGGAGAC GATACCTGGAGCTGAGTTCGACTCTTCCGACCGTTATCCACCCCCGCGATGTCACCCCGGAACCCGGCTGGCGAT CATACAACGGTGCTTGGATTTCATTGCCCAGTGTAGCGACAAAGAAAAGATGCGTTGGATAGTCGGCCACGCTGG AGTTGGAAAGTCGGCAATAATGCAGATCGTTGCTGAAAATGCTCCTGGTGTCATCGTTGCTTCAGTTTTTTTTTG CGCGGACGAACGTAAAGATGGATCTAAAACTTTCACGACTATTGCGTATCAACTCGCTGTCAAGTGCGAGCCCTA TCGTGCATTCATCCGGAACGAGATCACCAGAGATCCAGCTCTCTTTCGAAGAGCGCTACCAACCCAGTTCAACAA GTTCATTGTTGAACCATTCATCCGTCACTTAGTCAATTATCCGCATCGATTCGTCATTCTCATTGATGGCCTTGA CGAATGCAGCAATCCTCTCACACAACGAGAGCTGCTCGAGCTAATCTCGGGCTTTTGCATCCAATATCCTACGTC GCCGGTCGCATGGATTGTTGCCAGTCGCCCAGAGCCCATCATCACTCTGTTCTTTGACAAGCCCGAGGTTGCGCC AGCATATACAAAGGAGGACGTTGCAGTAGATTCAGATGAAGGGCGTCAAGATGTCGAATTATATCTCAGTGATGA ACTAGCAAAGATCAAACGCAACAACACTACGTTGCAGCATGAGGCAGAGTGGCCCTCCAAGCATGGCTTACTGAA GATCACTACAGCCTCGGGAGGGCTATTCGCGTATGCTTCAATAGTAGTCAAATATATCGACGACCCATACTACGG AGATCCAGCCTCTCAGTTTTTTGACGTCCTCGTGGTCATTGATGCGGGTCCGAAACGTGATAGACTGGGAAGAGA TCATCCTCTGGCTCCGCTCGATGCGTTGTATGAGAGGATTCTCTCCAAGATTCCACATGATGTGATGGTTAACAC CAGGAGGCTACTACTCCCGCAACGGTATTGGCGTTGGGGTGCGAATAAATTTCGTTTACAATGCAATCTCATGGG ATTGACTCAGCACGCTGCTTATGGCGCCGTTCGTCATATATGCTCCGTCGTGAAGGTTCCTATTCCTAACGAAGC TGACAAGAAATCCTTCAAGTTTTTCCACAAATCGTTTGATGACTATCTAGGCGACTTCGAACGATCCGGATTTTC CCCCGACATGCAGCAGGAAGCTAATGAGCTCATGGCTCAGATTTCATTGCGGGTAGCCGAGGAGGTTCTCGATGA CTCCGGAGATGAGGATGGTGGTGAAGTCATCGAGTGTCGGGACTATGGGTATTTGAAAGTTGGACCTGGCACCGG TTGTGACAACATTACCCTTTCTTGGCCTGGTGATGAGCGCTTCGAAAGGACCAACGACGAAGTCAAGGTCGAGTT GTACAGTAGTGCAATTACCGCCATTTCGGACCGATTTGCTCATCGCCACAAAGCCTTTTTGAATACATCCTGCTT CCGTGTGTTGACCAGGTGTTTCACTGCGCCTCGCATCTATTTTCCGTTTTACAAATTGCTAGATTTTGCTTTCGT AAGTGCTTCATGCTCTTTTTATCGCCAATGTTGAACTTCCGATAAGGACGATTTCCGGAATGAGCTTGTCGAGCT TGGCGTTCTGAAGCAAGTGTCTCTTAAGACATTAGATTATGCAGCAATCTGCGGACGAATAGAACTGCAATTTAT GAGCCCCATCGTGACAAATGTCAGAATATCTAATCCATGGAATCCTGTTTGCAAAGTGAGCTGTAGTATTTCGAT TGTCGAACGCACTGAATCTAAGTCTATACAGCATAAATCAGCTGACGTGCATGATTTGGGAGGGTGGCGGTGGTG TGGCTCGAAAACCACGTTTGGCAGATACGCAGAAGACGTGGATTCGAGCCAGGGTCCCGAGGTTGACCTCATAGA CATTCCTCGGTCGAGTATTGTTGAAGGCAACAAATCTCACTGGGGATGCCTCTCAGAAACACGTTGGAACGTTGA AAATTGCCATTTCTGCTTGGGGCGTCTTTTCCGTCTTTTTATTGACAGTCCAGATCTACCAGCTACTGTGTTCTT TGACTCGACTGGATTATGTTATGTGGAGTTGGCGTTTGTTGACCCGGATGATGGGGTGTCGCAGTGGAGGTACCG ATTTTTACATTCGGGTCTTCCGTCTGGTCATGCGGATTCTGTTACCTCGACGCCAACAGTTATCGAACATATAAA AACTGTCCAATATGCAAACATTAAAATGCATTTGTTCAGTTTAGCTCGTCGCTCTGGTTCATCTTCAGGTCACTT CACAACGGGCCCAGGTGTCGGAGCCATTGGCCCTCCTGCGAGTGCCAATCAAGGTTTCCCGGATGATCTTGACAT ACACACCGTGGCACCTGACTTCAAAAAGGAAGGAACAGATTGGTTCGCGATCTTCAACCCTAAAGTCAAAAGGCA ACTTGATGTCTCCTTGGTGCACACTCTGATGCACGATAGGTGCGTTAGCACGTGTCGTGTGTTGTCTCCGTTCTG ATCGGTCATTTGTAGTGTTGTTTGCTGCGTCAGATTCTCGGCTGATGGCAAATATCTCGCGACGGGATGTAACCG AACGGCTCAAATCTACGATACTAAGGCGGGTCAGAAGACATGGTATGTCAGCCATCGGCTTCTGTCAATTCATTG ACATTGATTATTTCATTGCTAGTGTTCTGGTCGACGAAGCTGCCGAGAAAGCTGGAGATCTCTACATTCGAAGCG TGTGTTTCAGTCCTGACGGCAAGTTCCTTGCAACGGGAGCAGAGGATAAACAAATCCGTGTAAGAATCACTTATT GATGTATCTCTTTTCAAACACTCATAACACGACGATAGATCTGGGATATTGGCAAGAAACGGATTCGCAACGTAT TCGATGGTCACCAACAAGAAATATACTCATTGGACTTTTCACCTGACGGTCGTCATCTTGTTTCCGGGTCCAATG GATGTATCGGGATTTGGGATATGGTTGATGGAACTTCAAAGTTTTTGACTATCGAAGATCCTGGTCCTCTACATC GCAACGCAGGCATTACATCAGTGGCTATCAGTCCGAATGGAAAATTTGCCGCCGCTGGAAGTCTGGACACTGTCG TGCGGATCTGGAATATACGTAGTGGAGTGTTAGTGGAAAGCCTGAAAGGGCATAGTGATAGCGTTTACAGTGTCG CTTTCACGCCTGATGGGAAGGGACTTGTGAGTGGGAGTCTGGATAAGACGTTGAAGTATTGGGATGTTGAGGCCC TTGGTCGTAGGTGGAGACGACGGCCTGTGATGAAGGGTAATTATGAGGCGGGATATGATGAAGGAAATCGTTGTA CCATGAATTTCACTGGGCACAAGGTGCGTTTTCTCTCCCCTTCCTTTTTGTTTCTTGCCTGACGTGGGTCGGAAG GATTACGTATTGAGTGTGGCAGTTTCGCACGATGGACAATGGGTCGTTTCAGGTTCCAAAGATCGTGGTGTGCAG TTTTGGGATGCGAAGAATGCGGTTGTGCAGTGTATGCTTCAAGGTCACAAGAATTCCAGTGCGTGGTTTCGTCTT CACGTCTCTCTGCGATTTCTCAGACCGGAATAGTTAATTCAATCGATTTGAGCCCAGCGGGAAGCTTGGCAACTG GAAGTGGGGATTGGCAAGCTAGAATTTGTGCGTATACGACTACAGGTTGTGGCCTCGTCTCTGACTTTTATCTTT CTCTACAGGGAGCTATAGTTCAGTACTATAA |