Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|696400
Gene name
Locationscaffold_08:524402..526265
Strand+
Gene length (bp)1863
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17921 Integrase_H2C2 Integrase zinc binding domain 1.9E-18 186 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 176 413 5.0E-16
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 184 508 1.0E-15
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 190 413 6.0E-15
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 164 413 2.0E-14
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 164 413 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 176 413 5.0E-16
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 184 508 1.0E-15
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 190 413 6.0E-15
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 164 413 2.0E-14
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 164 413 4.0E-14
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 189 413 4.0E-14
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 264 515 7.0E-09
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 129 515 1.0E-08
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 264 515 1.0E-08
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 264 515 1.0E-08
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 264 409 2.0E-08
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 264 515 2.0E-08
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 264 515 4.0E-08
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 264 425 9.0E-08
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 264 425 9.0E-08
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 264 425 1.0E-07
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 167 411 1.0E-07
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 264 409 1.0E-07
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 264 425 1.0E-07
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 264 515 2.0E-07
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 159 542 2.0E-07
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 264 515 2.0E-07
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 131 406 2.0E-07
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 152 542 5.0E-07
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 264 409 2.0E-06
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 159 542 2.0E-06
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 188 374 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|696400
MNRWISAILLFDFKLRHVPGKEHGPDGLSRRPPAPEDPPVNDDYEDWIDTANAFTTTIATSRQPDDLPWCLTTDT
FCIEVLNEIPPLQAVLLAHQHFHHKSALLTHVFTTTASPSSTPSIPRTDKARKRDANLDLVISFLLNPSRPSNIS
ESDFKKLVRLATGFFIQDGRLWKKDSRNKHKLVIRDEEKRLDLIRQAHDSLGHKGIFTTRTRLLDRFWWPDLDAD
VRWYIKTCHECQTRLIHHFHIPPTVPTPLNLFRKAHIDTMFMPRSHGYRYIVHARCFLSSYPEFRMLRAENARSL
ATFIFEDILCRWGAIEELVTDNGPAFIQAAEHLSAKYKINHIRISPYNSQANGIVERRHLDVREALVKASEGEEQ
HWTTAAPAVFWAERVSIQKSTGYSPYYIAHGLEPLLPFDLAEATYLAPSLTKPVSTEDLIAARALQLRKRPTDLA
QVKEDVLKARYASIREFNKKYENNIRDFDFDDGSLVLVRNSRHDKDLGSKTAPRHFGPMIVLRRTKGGSYILSEL
DGSISKLRFAAFRLVPYHPRNLRAVPVTKITDATPEQLDNYTYDVDSADLARPDTPQPQPSPLSPATHPIATSGL
VQLASKPLKHQPSPQNYLHD*
Coding >Agabi119p4|696400
ATGAACCGCTGGATTTCGGCCATCCTACTCTTCGACTTCAAGCTGCGACACGTACCCGGAAAGGAACACGGCCCC
GATGGCCTCTCTCGACGTCCACCTGCACCCGAAGATCCGCCAGTCAATGACGACTATGAAGACTGGATCGACACG
GCAAATGCATTCACTACTACAATCGCAACATCTCGCCAACCCGACGATTTACCATGGTGTCTCACCACCGACACC
TTCTGTATAGAAGTCCTCAACGAAATCCCGCCACTACAAGCCGTCCTACTGGCGCACCAGCACTTCCATCATAAG
TCTGCACTACTCACCCATGTTTTCACTACCACAGCATCACCCTCCTCGACGCCATCAATTCCCCGAACGGACAAG
GCCAGAAAACGAGATGCCAACCTCGATCTAGTAATCTCCTTTCTCCTGAACCCATCCCGACCTTCCAACATTTCT
GAAAGCGACTTCAAGAAGCTCGTACGTCTAGCAACAGGATTCTTCATTCAAGATGGACGGCTATGGAAGAAAGAT
AGTAGGAACAAGCATAAACTGGTTATAAGGGATGAGGAGAAACGGTTAGATCTAATACGGCAAGCCCACGATTCT
CTTGGACATAAGGGCATTTTCACCACTCGTACCCGCCTCCTAGATCGCTTCTGGTGGCCAGACCTCGATGCCGAC
GTCCGCTGGTACATCAAAACATGCCATGAATGCCAGACTCGACTCATCCACCACTTCCACATTCCCCCTACTGTT
CCTACACCTCTCAATCTGTTTCGCAAAGCTCACATCGACACAATGTTCATGCCCCGCTCGCATGGGTATCGTTAT
ATCGTCCACGCGCGCTGCTTCCTTTCTTCCTATCCCGAATTTCGAATGCTTCGTGCTGAAAACGCCCGATCGCTT
GCCACTTTCATTTTCGAAGACATACTGTGCCGCTGGGGAGCTATCGAGGAACTCGTTACAGACAACGGTCCTGCA
TTTATTCAAGCAGCAGAACACTTGTCAGCAAAATACAAGATCAACCATATCCGGATCTCACCCTACAACTCACAG
GCAAACGGTATCGTTGAACGACGTCACCTAGACGTTCGAGAAGCCCTTGTAAAGGCCTCTGAAGGAGAAGAGCAG
CATTGGACAACAGCTGCACCCGCTGTCTTTTGGGCTGAACGAGTATCTATTCAGAAATCAACAGGGTACTCACCG
TATTACATAGCCCACGGTCTCGAACCCCTCCTCCCTTTCGACCTCGCTGAAGCTACCTACCTCGCACCATCACTC
ACCAAACCTGTCTCCACTGAAGATCTCATCGCGGCTCGTGCTCTACAGCTTCGCAAACGTCCCACTGACCTTGCC
CAAGTAAAAGAAGATGTTCTGAAGGCTCGTTACGCCTCTATACGAGAATTCAACAAGAAATATGAAAATAACATT
CGCGACTTCGACTTCGACGACGGATCCCTCGTCCTTGTTCGTAACTCCAGACACGATAAGGACCTTGGCAGTAAA
ACGGCGCCACGTCATTTCGGCCCCATGATCGTGCTCAGAAGAACCAAGGGCGGATCTTACATACTCTCGGAACTC
GACGGCTCCATTTCCAAGCTGCGCTTTGCAGCCTTTCGACTTGTTCCCTACCATCCCCGCAACCTTCGAGCAGTT
CCCGTCACGAAAATCACAGACGCGACCCCAGAACAACTCGACAACTACACGTACGACGTCGATTCTGCCGACCTA
GCTCGTCCTGACACCCCACAACCCCAACCGTCGCCTCTTTCACCAGCAACACACCCTATAGCCACCTCAGGCCTC
GTTCAACTCGCTAGCAAGCCACTGAAACATCAACCGAGCCCTCAAAACTACCTGCACGACTAG
Transcript >Agabi119p4|696400
ATGAACCGCTGGATTTCGGCCATCCTACTCTTCGACTTCAAGCTGCGACACGTACCCGGAAAGGAACACGGCCCC
GATGGCCTCTCTCGACGTCCACCTGCACCCGAAGATCCGCCAGTCAATGACGACTATGAAGACTGGATCGACACG
GCAAATGCATTCACTACTACAATCGCAACATCTCGCCAACCCGACGATTTACCATGGTGTCTCACCACCGACACC
TTCTGTATAGAAGTCCTCAACGAAATCCCGCCACTACAAGCCGTCCTACTGGCGCACCAGCACTTCCATCATAAG
TCTGCACTACTCACCCATGTTTTCACTACCACAGCATCACCCTCCTCGACGCCATCAATTCCCCGAACGGACAAG
GCCAGAAAACGAGATGCCAACCTCGATCTAGTAATCTCCTTTCTCCTGAACCCATCCCGACCTTCCAACATTTCT
GAAAGCGACTTCAAGAAGCTCGTACGTCTAGCAACAGGATTCTTCATTCAAGATGGACGGCTATGGAAGAAAGAT
AGTAGGAACAAGCATAAACTGGTTATAAGGGATGAGGAGAAACGGTTAGATCTAATACGGCAAGCCCACGATTCT
CTTGGACATAAGGGCATTTTCACCACTCGTACCCGCCTCCTAGATCGCTTCTGGTGGCCAGACCTCGATGCCGAC
GTCCGCTGGTACATCAAAACATGCCATGAATGCCAGACTCGACTCATCCACCACTTCCACATTCCCCCTACTGTT
CCTACACCTCTCAATCTGTTTCGCAAAGCTCACATCGACACAATGTTCATGCCCCGCTCGCATGGGTATCGTTAT
ATCGTCCACGCGCGCTGCTTCCTTTCTTCCTATCCCGAATTTCGAATGCTTCGTGCTGAAAACGCCCGATCGCTT
GCCACTTTCATTTTCGAAGACATACTGTGCCGCTGGGGAGCTATCGAGGAACTCGTTACAGACAACGGTCCTGCA
TTTATTCAAGCAGCAGAACACTTGTCAGCAAAATACAAGATCAACCATATCCGGATCTCACCCTACAACTCACAG
GCAAACGGTATCGTTGAACGACGTCACCTAGACGTTCGAGAAGCCCTTGTAAAGGCCTCTGAAGGAGAAGAGCAG
CATTGGACAACAGCTGCACCCGCTGTCTTTTGGGCTGAACGAGTATCTATTCAGAAATCAACAGGGTACTCACCG
TATTACATAGCCCACGGTCTCGAACCCCTCCTCCCTTTCGACCTCGCTGAAGCTACCTACCTCGCACCATCACTC
ACCAAACCTGTCTCCACTGAAGATCTCATCGCGGCTCGTGCTCTACAGCTTCGCAAACGTCCCACTGACCTTGCC
CAAGTAAAAGAAGATGTTCTGAAGGCTCGTTACGCCTCTATACGAGAATTCAACAAGAAATATGAAAATAACATT
CGCGACTTCGACTTCGACGACGGATCCCTCGTCCTTGTTCGTAACTCCAGACACGATAAGGACCTTGGCAGTAAA
ACGGCGCCACGTCATTTCGGCCCCATGATCGTGCTCAGAAGAACCAAGGGCGGATCTTACATACTCTCGGAACTC
GACGGCTCCATTTCCAAGCTGCGCTTTGCAGCCTTTCGACTTGTTCCCTACCATCCCCGCAACCTTCGAGCAGTT
CCCGTCACGAAAATCACAGACGCGACCCCAGAACAACTCGACAACTACACGTACGACGTCGATTCTGCCGACCTA
GCTCGTCCTGACACCCCACAACCCCAACCGTCGCCTCTTTCACCAGCAACACACCCTATAGCCACCTCAGGCCTC
GTTCAACTCGCTAGCAAGCCACTGAAACATCAACCGAGCCCTCAAAACTACCTGCACGACTAG
Gene >Agabi119p4|696400
ATGAACCGCTGGATTTCGGCCATCCTACTCTTCGACTTCAAGCTGCGACACGTACCCGGAAAGGAACACGGCCCC
GATGGCCTCTCTCGACGTCCACCTGCACCCGAAGATCCGCCAGTCAATGACGACTATGAAGACTGGATCGACACG
GCAAATGCATTCACTACTACAATCGCAACATCTCGCCAACCCGACGATTTACCATGGTGTCTCACCACCGACACC
TTCTGTATAGAAGTCCTCAACGAAATCCCGCCACTACAAGCCGTCCTACTGGCGCACCAGCACTTCCATCATAAG
TCTGCACTACTCACCCATGTTTTCACTACCACAGCATCACCCTCCTCGACGCCATCAATTCCCCGAACGGACAAG
GCCAGAAAACGAGATGCCAACCTCGATCTAGTAATCTCCTTTCTCCTGAACCCATCCCGACCTTCCAACATTTCT
GAAAGCGACTTCAAGAAGCTCGTACGTCTAGCAACAGGATTCTTCATTCAAGATGGACGGCTATGGAAGAAAGAT
AGTAGGAACAAGCATAAACTGGTTATAAGGGATGAGGAGAAACGGTTAGATCTAATACGGCAAGCCCACGATTCT
CTTGGACATAAGGGCATTTTCACCACTCGTACCCGCCTCCTAGATCGCTTCTGGTGGCCAGACCTCGATGCCGAC
GTCCGCTGGTACATCAAAACATGCCATGAATGCCAGACTCGACTCATCCACCACTTCCACATTCCCCCTACTGTT
CCTACACCTCTCAATCTGTTTCGCAAAGCTCACATCGACACAATGTTCATGCCCCGCTCGCATGGGTATCGTTAT
ATCGTCCACGCGCGCTGCTTCCTTTCTTCCTATCCCGAATTTCGAATGCTTCGTGCTGAAAACGCCCGATCGCTT
GCCACTTTCATTTTCGAAGACATACTGTGCCGCTGGGGAGCTATCGAGGAACTCGTTACAGACAACGGTCCTGCA
TTTATTCAAGCAGCAGAACACTTGTCAGCAAAATACAAGATCAACCATATCCGGATCTCACCCTACAACTCACAG
GCAAACGGTATCGTTGAACGACGTCACCTAGACGTTCGAGAAGCCCTTGTAAAGGCCTCTGAAGGAGAAGAGCAG
CATTGGACAACAGCTGCACCCGCTGTCTTTTGGGCTGAACGAGTATCTATTCAGAAATCAACAGGGTACTCACCG
TATTACATAGCCCACGGTCTCGAACCCCTCCTCCCTTTCGACCTCGCTGAAGCTACCTACCTCGCACCATCACTC
ACCAAACCTGTCTCCACTGAAGATCTCATCGCGGCTCGTGCTCTACAGCTTCGCAAACGTCCCACTGACCTTGCC
CAAGTAAAAGAAGATGTTCTGAAGGCTCGTTACGCCTCTATACGAGAATTCAACAAGAAATATGAAAATAACATT
CGCGACTTCGACTTCGACGACGGATCCCTCGTCCTTGTTCGTAACTCCAGACACGATAAGGACCTTGGCAGTAAA
ACGGCGCCACGTCATTTCGGCCCCATGATCGTGCTCAGAAGAACCAAGGGCGGATCTTACATACTCTCGGAACTC
GACGGCTCCATTTCCAAGCTGCGCTTTGCAGCCTTTCGACTTGTTCCCTACCATCCCCGCAACCTTCGAGCAGTT
CCCGTCACGAAAATCACAGACGCGACCCCAGAACAACTCGACAACTACACGTACGACGTCGATTCTGCCGACCTA
GCTCGTCCTGACACCCCACAACCCCAACCGTCGCCTCTTTCACCAGCAACACACCCTATAGCCACCTCAGGCCTC
GTTCAACTCGCTAGCAAGCCACTGAAACATCAACCGAGCCCTCAAAACTACCTGCACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail