Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|695750
Gene name
Locationscaffold_08:492899..494109
Strand+
Gene length (bp)1210
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00294 PfkB pfkB family carbohydrate kinase 4.2E-38 2 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P44331|RBSK_HAEIN Ribokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rbsK PE=3 SV=1 6 320 5.0E-31
sp|Q9CF42|RBSK_LACLA Ribokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rbsK PE=3 SV=1 1 325 3.0E-26
sp|O60116|RBSK_SCHPO Putative ribokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.02c PE=3 SV=1 1 325 8.0E-25
sp|P25332|RBSK_YEAST Probable ribokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBK1 PE=1 SV=2 6 323 9.0E-25
sp|P0A9J6|RBSK_ECOLI Ribokinase OS=Escherichia coli (strain K12) GN=rbsK PE=1 SV=1 5 322 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P44331|RBSK_HAEIN Ribokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rbsK PE=3 SV=1 6 320 5.0E-31
sp|Q9CF42|RBSK_LACLA Ribokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rbsK PE=3 SV=1 1 325 3.0E-26
sp|O60116|RBSK_SCHPO Putative ribokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.02c PE=3 SV=1 1 325 8.0E-25
sp|P25332|RBSK_YEAST Probable ribokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBK1 PE=1 SV=2 6 323 9.0E-25
sp|P0A9J6|RBSK_ECOLI Ribokinase OS=Escherichia coli (strain K12) GN=rbsK PE=1 SV=1 5 322 1.0E-22
sp|P0A9J7|RBSK_ECO57 Ribokinase OS=Escherichia coli O157:H7 GN=rbsK PE=3 SV=1 5 322 1.0E-22
sp|Q54UQ4|RBSK_DICDI Probable ribokinase OS=Dictyostelium discoideum GN=rbsk PE=3 SV=2 6 321 3.0E-20
sp|P36945|RBSK_BACSU Ribokinase OS=Bacillus subtilis (strain 168) GN=rbsK PE=3 SV=2 1 323 4.0E-18
sp|Q9K6K1|RBSK_BACHD Ribokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rbsK PE=3 SV=1 2 322 2.0E-17
sp|Q8R1Q9|RBSK_MOUSE Ribokinase OS=Mus musculus GN=Rbks PE=1 SV=1 8 321 9.0E-17
sp|Q9H477|RBSK_HUMAN Ribokinase OS=Homo sapiens GN=RBKS PE=1 SV=1 8 321 2.0E-14
sp|P22824|SCRK_VIBAL Fructokinase OS=Vibrio alginolyticus GN=scrK PE=3 SV=1 38 326 2.0E-11
sp|Q9M1B9|SCRK4_ARATH Probable fructokinase-4 OS=Arabidopsis thaliana GN=At3g59480 PE=2 SV=1 32 322 2.0E-06
sp|Q9LNE3|SCRK2_ARATH Probable fructokinase-2 OS=Arabidopsis thaliana GN=At1g06030 PE=2 SV=1 30 316 2.0E-06
sp|O34768|YDJE_BACSU Uncharacterized sugar kinase YdjE OS=Bacillus subtilis (strain 168) GN=ydjE PE=3 SV=1 33 321 3.0E-06
sp|Q0JGZ6|SCRK1_ORYSJ Fructokinase-1 OS=Oryza sativa subsp. japonica GN=FRK1 PE=1 SV=2 32 321 4.0E-06
sp|Q9SID0|SCRK1_ARATH Probable fructokinase-1 OS=Arabidopsis thaliana GN=At2g31390 PE=2 SV=1 32 321 4.0E-06
sp|A2WXV8|SCRK1_ORYSI Fructokinase-1 OS=Oryza sativa subsp. indica GN=FRK1 PE=1 SV=1 32 321 5.0E-06
sp|Q6XZ79|SCRK1_MAIZE Fructokinase-1 OS=Zea mays GN=FRK1 PE=1 SV=1 32 321 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|695750
MPHCLVRGSINVDEYYYVSHISRPGETISSHGFQQRMGGKGFNQAVALALATGGGDQGKVSFYGTVGDDDAGKGL
RERLVSEWGLKNDFLFLDNEKATGRAIIQVADDGENSIVLFPGANHSEIIEVQDKLWPSETTHVLLQNEINLNST
LRAIEFAEKLVTIFNPSPMLHKDEIVGFPWNKIDWLIVNQLEARLLLASLDPSQDVQDEEDVRNVLQNLVNQPAF
SKTRIVCTLGAGGVYAIGNGLSLAFAPAARLEGPVVDTTGAGDTFAGYFIGELMSFEGREIRELDVVRLLRVATR
AAAMCVERAGTVDSMPKREEVERRFGV*
Coding >Agabi119p4|695750
ATGCCTCACTGTCTTGTTCGAGGGTCGATCAACGTTGATGAGTACTATTATGTATCGCATATATCGAGACCGGGA
GAAACGATATCGTCTCATGGATTTCAACAACGTATGGGAGGAAAGGGGTTTAATCAGGCTGTAGCACTCGCTTTG
GCTACTGGAGGAGGAGATCAAGGAAAAGTGAGTTTTTATGGGACTGTTGGGGATGATGATGCTGGGAAAGGGTTG
AGAGAGAGGTTGGTGAGTGAGTGGGGTTTGAAGAATGATTTTTTGTTTTTGGATAATGAGAAAGCGACGGGGAGG
GCGATTATTCAAGTTGCTGATGATGGAGAGAATAGTATTGTGTTATTTCCTGGAGCAAATCACAGTGAAATTATC
GAAGTACAAGATAAATTATGGCCTTCAGAAACTACACACGTTCTATTACAAAACGAAATAAACCTCAATTCGACA
TTGAGGGCTATCGAATTTGCAGAAAAACTTGTGACGATATTTAATCCCTCTCCGATGCTTCATAAAGACGAAATC
GTTGGTTTTCCGTGGAATAAGATTGATTGGCTTATTGTCAACCAATTGGAGGCTAGGTTATTATTGGCGTCGTTG
GATCCTTCACAAGATGTCCAGGACGAGGAGGATGTTCGGAATGTTCTGCAAAACTTGGTTAATCAACCGGCATTC
AGCAAAACACGTATTGTCTGCACACTTGGTGCTGGAGGTGTATACGCTATCGGCAATGGATTATCTCTGGCGTTC
GCACCAGCTGCGCGTTTAGAAGGTCCAGTTGTCGATACCACCGGAGCTGGAGATACGTTTGCGGGATATTTTATA
GGAGAGCTCATGTCGTTTGAGGGGCGGGAGATACGGGAACTTGATGTTGTACGGTTATTGAGAGTGGCTACGCGG
GCGGCGGCGATGTGTGTTGAACGAGCAGGGACGGTGGATAGTATGCCGAAACGGGAGGAGGTTGAACGGAGATTC
GGAGTATAA
Transcript >Agabi119p4|695750
ATGCCTCACTGTCTTGTTCGAGGGTCGATCAACGTTGATGAGTACTATTATGTATCGCATATATCGAGACCGGGA
GAAACGATATCGTCTCATGGATTTCAACAACGTATGGGAGGAAAGGGGTTTAATCAGGCTGTAGCACTCGCTTTG
GCTACTGGAGGAGGAGATCAAGGAAAAGTGAGTTTTTATGGGACTGTTGGGGATGATGATGCTGGGAAAGGGTTG
AGAGAGAGGTTGGTGAGTGAGTGGGGTTTGAAGAATGATTTTTTGTTTTTGGATAATGAGAAAGCGACGGGGAGG
GCGATTATTCAAGTTGCTGATGATGGAGAGAATAGTATTGTGTTATTTCCTGGAGCAAATCACAGTGAAATTATC
GAAGTACAAGATAAATTATGGCCTTCAGAAACTACACACGTTCTATTACAAAACGAAATAAACCTCAATTCGACA
TTGAGGGCTATCGAATTTGCAGAAAAACTTGTGACGATATTTAATCCCTCTCCGATGCTTCATAAAGACGAAATC
GTTGGTTTTCCGTGGAATAAGATTGATTGGCTTATTGTCAACCAATTGGAGGCTAGGTTATTATTGGCGTCGTTG
GATCCTTCACAAGATGTCCAGGACGAGGAGGATGTTCGGAATGTTCTGCAAAACTTGGTTAATCAACCGGCATTC
AGCAAAACACGTATTGTCTGCACACTTGGTGCTGGAGGTGTATACGCTATCGGCAATGGATTATCTCTGGCGTTC
GCACCAGCTGCGCGTTTAGAAGGTCCAGTTGTCGATACCACCGGAGCTGGAGATACGTTTGCGGGATATTTTATA
GGAGAGCTCATGTCGTTTGAGGGGCGGGAGATACGGGAACTTGATGTTGTACGGTTATTGAGAGTGGCTACGCGG
GCGGCGGCGATGTGTGTTGAACGAGCAGGGACGGTGGATAGTATGCCGAAACGGGAGGAGGTTGAACGGAGATTC
GGAGTATAA
Gene >Agabi119p4|695750
ATGCCTCACTGTCTTGTTCGAGGGTCGATCAGTATGTTTTTTGATACAGAATCGCTACGCGTTCTAATCTCAAGA
ATTAGACGTTGATGAGTACTATTATGGTTCGTCCGCTTGTTGACAACAAACTCGATTCTCATATCTCATATACAT
AGTATCGCATATATCGAGACCGGGAGAAACGATATCGTCTCATGGATTTCAACAACGTATGGGAGGAAAGGGGTT
TAATCAGGCTGTAGCACTCGCTTTGGCTACTGGAGGAGGAGATCAAGGAAAAGTGAGTTTTTATGGGACTGTTGG
GGATGATGATGCTGGGAAAGGGTTGAGAGAGAGGTTGGTGAGTGAGTGGGGTTTGAAGAATGATTTTTTGTTTTT
GGATAATGTGTGTTTTCTTTCGTTTTTCGTTTTGTTTTTGTTTTTGTTTTTGAGATTTTTGTTTTGGTTGTAGGA
GAAAGCGACGGGGAGGGCGATTATTCAAGTTGCTGATGATGGAGAGAATAGTATTGGTATGTATATAACCTTTAC
TATATGCGTTCGTTCAGTCGTCCTCACTCAATCAAATGTAGTGTTATTTCCTGGAGCAAATCACAGTGAAATTAT
CGAAGTACAAGATAAATTATGGCCTTCAGAAACTACACACGTTCTATTACAAAACGAAATAAACCTCAATTCGAC
ATTGAGGGCTATCGAATTTGCAGAAAAACTTGTGACGATATTTAATCCCTCTCCGATGCTTCATAAAGACGAAAT
CGTTGGTTTTCCGTGGAATAAGATTGATTGGCTTATTGTCAACCAATTGGAGGCTAGGTTATTATTGGCGTCGTT
GGATCCTTCACAAGATGTCCAGGACGAGGAGGATGTTCGGAATGTTCTGCAAAACTTGGTTAATCAACCGGCATT
CAGCAAAACACGTATTGTCTGCACACTTGGTGCTGGAGGTGTATACGCTATCGGCAATGGATTATCTCTGGCGTT
CGCACCAGCTGCGCGTTTAGAAGGTCCAGTTGTCGATACCACCGGAGCTGGAGATACGTTTGCGGGATATTTTAT
AGGAGAGCTCATGTCGTTTGAGGGGCGGGAGATACGGGAACTTGATGTTGTACGGTTATTGAGAGTGGCTACGCG
GGCGGCGGCGATGTGTGTTGAACGAGCAGGGACGGTGGATAGTATGCCGAAACGGGAGGAGGTTGAACGGAGATT
CGGAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail