Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|686850
Gene name
Locationscaffold_07:2122561..2123824
Strand-
Gene length (bp)1263
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 3.7E-24 42 162
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 4.7E-22 188 310
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 1.3E-07 42 107
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 2.6E-10 188 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 125 269 6.0E-12
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 126 267 4.0E-11
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 126 267 9.0E-11
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 43 175 1.0E-10
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 170 308 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 125 269 6.0E-12
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 126 267 4.0E-11
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 126 267 9.0E-11
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 43 175 1.0E-10
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 170 308 2.0E-10
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 133 267 2.0E-10
sp|A8W969|AGB34_AGAAL Beta-agarase AgaB34 OS=Agarivorans albus GN=agaB34 PE=3 SV=1 125 309 2.0E-10
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 133 267 2.0E-10
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 41 175 2.0E-10
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 43 164 2.0E-09
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 193 310 3.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 193 310 2.0E-08
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 166 301 5.0E-08
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 166 301 3.0E-07
sp|Q05308|SP1_RARFA Serine protease 1 OS=Rarobacter faecitabidus PE=1 SV=1 194 311 8.0E-07
sp|Q05308|SP1_RARFA Serine protease 1 OS=Rarobacter faecitabidus PE=1 SV=1 46 162 2.0E-06
sp|Q05308|SP1_RARFA Serine protease 1 OS=Rarobacter faecitabidus PE=1 SV=1 134 266 2.0E-06
sp|P02879|RICI_RICCO Ricin OS=Ricinus communis PE=1 SV=1 15 310 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|686850
MYSLNGLVAATLLLSNGLGGLASPLVPRQKVGPVGTLHPISSSEKCIDVRGAAFENGTAVQIFDCNGSDAQNWMI
QRGVAGHIEVEGTGFCLDAGSSPANGVGMKIWQCFDNLPAQQWTYNSDNQIKLADKDFCLDLTDGNSGNSNQLQI
WECSTGNRNQVWLEGPPGNGESTPPPPPPPTSRALHSNVDGSKCMDVEGAVFANGTPVQIFDCNGSNAQQWTLTD
GNTKVQVAGTNFCLDATSANPANGAGMKIWECFDGLAAQSWTYTDSHHLQLQSSAKCIDMTNGDTTNGNQLQVFD
CFDGNNNQIWN*
Coding >Agabi119p4|686850
ATGTATAGCTTGAACGGACTCGTCGCTGCCACTTTGCTTCTCTCTAATGGACTAGGTGGCTTGGCAAGCCCTCTC
GTTCCACGCCAGAAAGTTGGTCCTGTGGGGACTCTCCATCCCATTTCCAGCTCTGAGAAATGTATTGATGTTCGT
GGCGCCGCTTTCGAGAATGGAACTGCTGTCCAAATCTTCGATTGTAATGGTAGCGACGCGCAGAATTGGATGATT
CAACGTGGAGTAGCTGGCCATATCGAGGTAGAAGGAACCGGTTTCTGTCTTGATGCCGGCAGCAGCCCAGCTAAT
GGTGTCGGAATGAAGATATGGCAATGTTTCGACAATCTCCCTGCTCAACAGTGGACCTACAACAGCGATAATCAG
ATCAAGCTTGCAGACAAAGATTTTTGTCTCGATTTGACGGACGGAAACTCGGGAAATTCTAATCAATTACAGATT
TGGGAGTGCAGCACCGGTAATAGAAATCAAGTGTGGCTTGAAGGTCCTCCCGGAAATGGAGAGTCCACTCCACCG
CCTCCACCGCCTCCTACGAGCCGTGCGCTTCACTCCAATGTAGATGGCAGCAAATGCATGGATGTCGAAGGTGCA
GTTTTCGCTAACGGCACACCTGTTCAAATCTTTGACTGCAATGGCAGTAACGCTCAGCAATGGACTCTTACCGAC
GGTAATACCAAAGTCCAAGTGGCCGGAACGAACTTCTGTCTTGATGCCACTTCTGCCAATCCGGCAAACGGTGCA
GGAATGAAAATCTGGGAATGTTTCGACGGTCTTGCTGCTCAGAGTTGGACTTACACCGACAGTCACCATCTCCAA
CTCCAGTCCTCAGCCAAGTGCATTGATATGACGAATGGAGACACAACGAACGGGAATCAGCTTCAGGTTTTCGAT
TGCTTTGACGGCAACAATAACCAGATCTGGAATTAA
Transcript >Agabi119p4|686850
ATGTATAGCTTGAACGGACTCGTCGCTGCCACTTTGCTTCTCTCTAATGGACTAGGTGGCTTGGCAAGCCCTCTC
GTTCCACGCCAGAAAGTTGGTCCTGTGGGGACTCTCCATCCCATTTCCAGCTCTGAGAAATGTATTGATGTTCGT
GGCGCCGCTTTCGAGAATGGAACTGCTGTCCAAATCTTCGATTGTAATGGTAGCGACGCGCAGAATTGGATGATT
CAACGTGGAGTAGCTGGCCATATCGAGGTAGAAGGAACCGGTTTCTGTCTTGATGCCGGCAGCAGCCCAGCTAAT
GGTGTCGGAATGAAGATATGGCAATGTTTCGACAATCTCCCTGCTCAACAGTGGACCTACAACAGCGATAATCAG
ATCAAGCTTGCAGACAAAGATTTTTGTCTCGATTTGACGGACGGAAACTCGGGAAATTCTAATCAATTACAGATT
TGGGAGTGCAGCACCGGTAATAGAAATCAAGTGTGGCTTGAAGGTCCTCCCGGAAATGGAGAGTCCACTCCACCG
CCTCCACCGCCTCCTACGAGCCGTGCGCTTCACTCCAATGTAGATGGCAGCAAATGCATGGATGTCGAAGGTGCA
GTTTTCGCTAACGGCACACCTGTTCAAATCTTTGACTGCAATGGCAGTAACGCTCAGCAATGGACTCTTACCGAC
GGTAATACCAAAGTCCAAGTGGCCGGAACGAACTTCTGTCTTGATGCCACTTCTGCCAATCCGGCAAACGGTGCA
GGAATGAAAATCTGGGAATGTTTCGACGGTCTTGCTGCTCAGAGTTGGACTTACACCGACAGTCACCATCTCCAA
CTCCAGTCCTCAGCCAAGTGCATTGATATGACGAATGGAGACACAACGAACGGGAATCAGCTTCAGGTTTTCGAT
TGCTTTGACGGCAACAATAACCAGATCTGGAATTAA
Gene >Agabi119p4|686850
ATGTATAGCTTGAACGGACTCGTCGCTGCCACTTTGCTTCTCTCTAATGGACTAGGTGGCTTGGCAAGCCCTCTC
GTTCCACGCCAGAAAGTTGGTCCTGTGGGGACTCTCCATCCCATTTCCAGCTCTGAGAAATGTATTGATGTTCGT
GGCGCCGCTTTCGAGAATGGAACTGCTGTCCAAATGTTCGTTCCCTTTCAAAAGCACGTTTATTTCATCTTCTAA
CGTTACTTATTGTAGCTTCGATTGTAATGGTAGCGACGCGCAGAATTGGATGATTCAACGTGGAGTAGCTGGCCA
TATCGAGGTAGAAGGAACCGGTTTCTGTCTTGATGCCGGCAGCAGTAAGGAACCTTGGATTCAAGTTTCTGTCAT
CGTATACTAATCCTCTTCAGGCCCAGCTAATGGTGTCGGAATGAAGATATGGCAATGTTTCGACAATCTCCCTGC
TCAACAGTGGACCTACAACAGCGATAATCAGATCAAGCTTGCAGACAAAGGTTTGTCTCTGCTGCTCACCTGTTA
GGGTCGCGCATTATATACTACATGCCATAGATTTTTGTCTCGATTTGACGGACGGAAACTCGGGAAATTCTAATC
AATTACAGATTTGGGAGTGCAGCACCGGTAATAGAAATCAAGTGTGGCTTGAAGGTCCTCCCGGAAATGGAGAGT
CCACTCCACCGCCTCCACCGCCTCCTACGAGCCGTGCGCTTCACTCCAATGTAGATGGCAGCAAATGCATGGATG
TCGAAGGTGCAGTTTTCGCTAACGGCACACCTGTTCAAATGTCTGTTTTCTTCCTATTTGCGATCGGCCTTGAGT
CTGACATTTGTTCAGCTTTGACTGCAATGGCAGTAACGCTCAGCAATGGACTCTTACCGACGGTAATACCAAAGT
CCAAGTGGCCGGAACGAACTTCTGTCTTGATGCCACTTCTGCCAGTAAGTCTTGGACTTATATCCGATATTGATC
AAGCATTTAATTTCATCTTAGATCCGGCAAACGGTGCAGGAATGAAAATCTGGGAATGTTTCGACGGTCTTGCTG
CTCAGAGTTGGACTTACACCGACAGTCACCATCTCCAACTCCAGTCCTCAGGTATGTTGCTGCTTCTTCTCCACC
GATTCCGTCTTGTTTAAACTTAACACGGTCATTTATCCAGCCAAGTGCATTGATATGACGAATGGAGACACAACG
AACGGGAATCAGCTTCAGGTTTTCGATTGCTTTGACGGCAACAATAACCAGATCTGGAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail