Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|685900
Gene name
Locationscaffold_07:1969537..1970850
Strand+
Gene length (bp)1313
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01095 Pectinesterase Pectinesterase 1.9E-37 38 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17872|PME_ASPTU Pectinesterase OS=Aspergillus tubingensis GN=pme1 PE=1 SV=1 12 334 1.0E-69
sp|Q12535|PME_ASPAC Pectinesterase OS=Aspergillus aculeatus GN=pme1 PE=2 SV=1 19 334 2.0E-65
sp|Q5B7U0|PMEA_EMENI Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pmeA PE=1 SV=1 22 333 7.0E-64
sp|A2QK82|PMEA_ASPNC Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pmeA PE=3 SV=1 22 333 3.0E-62
sp|A1DBT4|PMEA_NEOFI Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pmeA PE=3 SV=1 21 333 4.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17872|PME_ASPTU Pectinesterase OS=Aspergillus tubingensis GN=pme1 PE=1 SV=1 12 334 1.0E-69
sp|Q12535|PME_ASPAC Pectinesterase OS=Aspergillus aculeatus GN=pme1 PE=2 SV=1 19 334 2.0E-65
sp|Q5B7U0|PMEA_EMENI Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pmeA PE=1 SV=1 22 333 7.0E-64
sp|A2QK82|PMEA_ASPNC Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pmeA PE=3 SV=1 22 333 3.0E-62
sp|A1DBT4|PMEA_NEOFI Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pmeA PE=3 SV=1 21 333 4.0E-62
sp|B8NPS7|PMEA_ASPFN Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pmeA PE=3 SV=1 12 333 5.0E-59
sp|Q4WBT5|PMEA_ASPFU Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pmeA PE=3 SV=1 21 333 5.0E-59
sp|B0Y9F9|PMEA_ASPFC Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pmeA PE=3 SV=1 21 333 5.0E-59
sp|Q2UBD9|PMEA_ASPOR Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pmeA PE=3 SV=1 23 333 8.0E-59
sp|Q9LVQ0|PME31_ARATH Pectinesterase 31 OS=Arabidopsis thaliana GN=PME31 PE=1 SV=1 28 324 5.0E-35
sp|Q5MFV6|PME37_ARATH Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana GN=VGDH2 PE=2 SV=2 40 329 2.0E-32
sp|Q9ZQA3|PME15_ARATH Probable pectinesterase 15 OS=Arabidopsis thaliana GN=PME15 PE=2 SV=1 30 324 2.0E-30
sp|Q84WM7|PPME1_ARATH Pectinesterase PPME1 OS=Arabidopsis thaliana GN=PPME1 PE=1 SV=1 41 315 9.0E-29
sp|O48711|PME12_ARATH Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana GN=PME12 PE=2 SV=1 27 303 2.0E-27
sp|Q9SIJ9|PME11_ARATH Putative pectinesterase 11 OS=Arabidopsis thaliana GN=PME11 PE=3 SV=1 30 322 2.0E-27
sp|Q5MFV8|PME5_ARATH Pectinesterase 5 OS=Arabidopsis thaliana GN=PME5 PE=1 SV=2 40 322 3.0E-27
sp|B2VPR8|AL11B_OLEEU Pectinesterase 2 OS=Olea europaea PE=1 SV=1 30 329 5.0E-27
sp|Q9LY18|PME49_ARATH Probable pectinesterase 49 OS=Arabidopsis thaliana GN=PME49 PE=2 SV=1 32 315 5.0E-27
sp|Q9LY19|PME48_ARATH Probable pectinesterase 48 OS=Arabidopsis thaliana GN=PME48 PE=2 SV=2 41 315 6.0E-27
sp|O04887|PME2_CITSI Pectinesterase 2 OS=Citrus sinensis GN=PECS-2.1 PE=2 SV=1 23 329 6.0E-27
sp|Q9FKF3|PME63_ARATH Putative pectinesterase 63 OS=Arabidopsis thaliana GN=PME63 PE=3 SV=2 35 318 9.0E-27
sp|D8VPP5|AL11A_OLEEU Pectinesterase 1 OS=Olea europaea PE=1 SV=1 32 329 9.0E-27
sp|P41510|PME_BRANA Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus GN=BP19 PE=2 SV=1 40 329 4.0E-26
sp|Q8VYZ3|PME53_ARATH Probable pectinesterase 53 OS=Arabidopsis thaliana GN=PME53 PE=2 SV=1 17 331 4.0E-26
sp|O23038|PME8_ARATH Probable pectinesterase 8 OS=Arabidopsis thaliana GN=PME8 PE=2 SV=2 43 311 4.0E-26
sp|Q7Y201|PME13_ARATH Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana GN=PME13 PE=2 SV=2 40 327 6.0E-26
sp|Q9FJ21|PME58_ARATH Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana GN=PME58 PE=2 SV=1 40 316 7.0E-26
sp|O80722|PME4_ARATH Pectinesterase 4 OS=Arabidopsis thaliana GN=PME4 PE=2 SV=1 40 322 1.0E-25
sp|Q8RXK7|PME41_ARATH Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana GN=PME41 PE=2 SV=2 32 324 2.0E-25
sp|Q1JPL7|PME18_ARATH Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana GN=PME18 PE=1 SV=3 18 321 3.0E-25
sp|Q42608|PME_BRACM Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris PE=2 SV=1 40 329 4.0E-25
sp|Q9LY17|PME50_ARATH Probable pectinesterase 50 OS=Arabidopsis thaliana GN=PME50 PE=2 SV=1 28 315 1.0E-24
sp|Q4PT34|PME56_ARATH Probable pectinesterase 56 OS=Arabidopsis thaliana GN=PME56 PE=2 SV=1 21 271 2.0E-24
sp|Q8LPF3|PME68_ARATH Probable pectinesterase 68 OS=Arabidopsis thaliana GN=PME68 PE=2 SV=1 27 321 5.0E-24
sp|Q9SMY6|PME45_ARATH Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana GN=PME45 PE=2 SV=1 40 317 8.0E-24
sp|Q9ZQA4|PME14_ARATH Putative pectinesterase 14 OS=Arabidopsis thaliana GN=PME14 PE=2 SV=1 26 316 1.0E-23
sp|Q96575|PME22_SOLLC Pectinesterase 2.2 OS=Solanum lycopersicum GN=PME2.2 PE=3 SV=1 40 303 1.0E-23
sp|Q9SG77|PME24_ARATH Putative pectinesterase/pectinesterase inhibitor 24 OS=Arabidopsis thaliana GN=PME24 PE=3 SV=1 40 329 4.0E-23
sp|Q9SRX4|PME7_ARATH Probable pectinesterase/pectinesterase inhibitor 7 OS=Arabidopsis thaliana GN=PME7 PE=2 SV=1 32 303 4.0E-23
sp|Q1PEC0|PME42_ARATH Probable pectinesterase/pectinesterase inhibitor 42 OS=Arabidopsis thaliana GN=PME42 PE=2 SV=1 40 329 5.0E-23
sp|Q9FM79|PME62_ARATH Pectinesterase QRT1 OS=Arabidopsis thaliana GN=QRT1 PE=2 SV=1 32 315 5.0E-23
sp|P83218|PME_DAUCA Pectinesterase OS=Daucus carota PE=1 SV=1 40 303 1.0E-22
sp|Q9LSP1|PME67_ARATH Probable pectinesterase 67 OS=Arabidopsis thaliana GN=PME67 PE=2 SV=1 1 315 1.0E-22
sp|Q9LYT5|PME35_ARATH Probable pectinesterase/pectinesterase inhibitor 35 OS=Arabidopsis thaliana GN=PME35 PE=2 SV=1 40 329 2.0E-22
sp|P14280|PME1_SOLLC Pectinesterase 1 OS=Solanum lycopersicum GN=PME1.9 PE=1 SV=5 40 303 2.0E-22
sp|Q43043|PME_PETIN Pectinesterase OS=Petunia integrifolia GN=PPE1 PE=2 SV=1 40 303 4.0E-22
sp|O49298|PME6_ARATH Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana GN=PME6 PE=2 SV=1 18 303 4.0E-22
sp|O04953|PME52_ARATH Putative pectinesterase 52 OS=Arabidopsis thaliana GN=PME52 PE=2 SV=2 111 329 4.0E-22
sp|P83948|PME3_CITSI Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1 40 312 5.0E-22
sp|Q3EAY9|PME30_ARATH Probable pectinesterase 30 OS=Arabidopsis thaliana GN=PME30 PE=2 SV=1 40 303 7.0E-22
sp|P09607|PME21_SOLLC Pectinesterase 2.1 OS=Solanum lycopersicum GN=PME2.1 PE=2 SV=2 40 303 8.0E-22
sp|O64479|PME10_ARATH Putative pectinesterase 10 OS=Arabidopsis thaliana GN=PME10 PE=2 SV=1 11 316 9.0E-22
sp|Q84JX1|PME19_ARATH Probable pectinesterase/pectinesterase inhibitor 19 OS=Arabidopsis thaliana GN=PME19 PE=2 SV=1 40 329 1.0E-21
sp|Q8GXA1|PME23_ARATH Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana GN=PME23 PE=2 SV=3 18 316 2.0E-21
sp|Q96576|PME3_SOLLC Pectinesterase 3 OS=Solanum lycopersicum GN=PME3 PE=3 SV=1 40 303 2.0E-21
sp|Q43062|PME_PRUPE Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica PE=2 SV=1 40 321 3.0E-21
sp|Q9LXK7|PME32_ARATH Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana GN=PME32 PE=2 SV=1 40 321 3.0E-21
sp|Q43143|PMEU1_SOLLC Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum GN=PMEU1 PE=2 SV=1 40 316 8.0E-21
sp|Q9FF78|PME46_ARATH Probable pectinesterase/pectinesterase inhibitor 46 OS=Arabidopsis thaliana GN=PME46 PE=2 SV=1 40 329 8.0E-21
sp|Q84R10|PME36_ARATH Probable pectinesterase/pectinesterase inhibitor 36 OS=Arabidopsis thaliana GN=PME36 PE=2 SV=2 22 331 1.0E-20
sp|Q9M9W7|PME22_ARATH Putative pectinesterase/pectinesterase inhibitor 22 OS=Arabidopsis thaliana GN=PME22 PE=3 SV=1 40 303 1.0E-20
sp|Q3E9D3|PME55_ARATH Probable pectinesterase 55 OS=Arabidopsis thaliana GN=PME55 PE=2 SV=1 9 330 2.0E-20
sp|Q94CB1|PME25_ARATH Probable pectinesterase/pectinesterase inhibitor 25 OS=Arabidopsis thaliana GN=PME25 PE=2 SV=1 39 334 3.0E-20
sp|Q4PSN0|PME29_ARATH Probable pectinesterase 29 OS=Arabidopsis thaliana GN=PME29 PE=2 SV=1 8 310 4.0E-20
sp|P83947|PME1_FICPW Pectinesterase/pectinesterase inhibitor OS=Ficus pumila var. awkeotsang PE=1 SV=1 40 303 4.0E-20
sp|Q3E8Z8|PME28_ARATH Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana GN=PME28 PE=2 SV=1 40 329 4.0E-20
sp|Q8L7Q7|PME64_ARATH Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana GN=PME64 PE=2 SV=2 42 324 1.0E-19
sp|Q4PSQ5|PME66_ARATH Probable pectinesterase 66 OS=Arabidopsis thaliana GN=PME66 PE=2 SV=2 11 324 1.0E-19
sp|Q9FF77|PME47_ARATH Probable pectinesterase/pectinesterase inhibitor 47 OS=Arabidopsis thaliana GN=PME47 PE=2 SV=1 29 334 2.0E-19
sp|Q42920|PME_MEDSA Pectinesterase/pectinesterase inhibitor OS=Medicago sativa PE=2 SV=1 40 315 2.0E-19
sp|Q43111|PME3_PHAVU Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=2 SV=1 40 321 2.0E-19
sp|Q9LUL8|PME26_ARATH Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana GN=PME26 PE=2 SV=1 40 303 2.0E-19
sp|O22149|PME17_ARATH Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana GN=PME17 PE=2 SV=2 24 329 2.0E-19
sp|O22256|PME20_ARATH Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana GN=PME20 PE=2 SV=2 32 303 3.0E-19
sp|O04886|PME1_CITSI Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE=2 SV=1 18 312 4.0E-19
sp|Q9SMY7|PME44_ARATH Probable pectinesterase/pectinesterase inhibitor 44 OS=Arabidopsis thaliana GN=PME44 PE=2 SV=2 40 321 8.0E-19
sp|P85076|PME_ACTDE Pectinesterase OS=Actinidia deliciosa PE=1 SV=1 40 303 1.0E-18
sp|Q8GX86|PME21_ARATH Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana GN=PME21 PE=2 SV=2 40 329 2.0E-18
sp|Q9LXD9|PME51_ARATH Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana GN=PME51 PE=2 SV=1 43 331 2.0E-18
sp|Q42534|PME2_ARATH Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 PE=2 SV=2 40 303 6.0E-18
sp|O81415|PME39_ARATH Probable pectinesterase/pectinesterase inhibitor 39 OS=Arabidopsis thaliana GN=PME39 PE=2 SV=1 40 330 8.0E-18
sp|Q43867|PME1_ARATH Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 PE=1 SV=1 40 325 8.0E-18
sp|O49006|PME3_ARATH Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana GN=PME3 PE=2 SV=2 40 303 1.0E-17
sp|Q3E989|PME54_ARATH Probable pectinesterase/pectinesterase inhibitor 54 OS=Arabidopsis thaliana GN=PME54 PE=2 SV=1 115 317 3.0E-17
sp|O81320|PME38_ARATH Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana GN=PME38 PE=3 SV=1 115 329 1.0E-16
sp|Q9SKX2|PME16_ARATH Probable pectinesterase/pectinesterase inhibitor 16 OS=Arabidopsis thaliana GN=PME16 PE=2 SV=1 40 321 2.0E-16
sp|Q9FHN4|PME60_ARATH Probable pectinesterase/pectinesterase inhibitor 60 OS=Arabidopsis thaliana GN=PME60 PE=2 SV=1 40 303 3.0E-16
sp|O81301|PME40_ARATH Probable pectinesterase/pectinesterase inhibitor 40 OS=Arabidopsis thaliana GN=PME40 PE=2 SV=1 40 303 3.0E-16
sp|Q9FHN5|PME59_ARATH Probable pectinesterase/pectinesterase inhibitor 59 OS=Arabidopsis thaliana GN=PME59 PE=2 SV=1 40 303 4.0E-16
sp|Q9FK05|PME61_ARATH Probable pectinesterase/pectinesterase inhibitor 61 OS=Arabidopsis thaliana GN=PME61 PE=2 SV=1 40 329 2.0E-15
sp|O23447|PME43_ARATH Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana GN=PME43 PE=2 SV=1 40 275 2.0E-15
sp|Q9STY3|PME33_ARATH Probable pectinesterase/pectinesterase inhibitor 33 OS=Arabidopsis thaliana GN=PME33 PE=2 SV=1 40 303 3.0E-14
sp|Q9M3B0|PME34_ARATH Probable pectinesterase/pectinesterase inhibitor 34 OS=Arabidopsis thaliana GN=PME34 PE=2 SV=1 40 321 4.0E-14
sp|P0C1A8|PMEA_DICCH Pectinesterase A OS=Dickeya chrysanthemi GN=pemA PE=1 SV=1 13 322 8.0E-11
sp|P0C1A9|PMEA_DICD3 Pectinesterase A OS=Dickeya dadantii (strain 3937) GN=pemA PE=1 SV=1 13 322 1.0E-10
sp|P24791|PME_RALSL Pectinesterase OS=Ralstonia solanacearum GN=pme PE=3 SV=1 40 248 2.0E-08
sp|P58601|PME_RALSO Pectinesterase OS=Ralstonia solanacearum (strain GMI1000) GN=pme PE=3 SV=1 40 248 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0030599 pectinesterase activity Yes
GO:0042545 cell wall modification Yes
GO:0045229 external encapsulating structure organization No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0052689 carboxylic ester hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0071840 cellular component organization or biogenesis No
GO:0071554 cell wall organization or biogenesis No
GO:0003674 molecular_function No
GO:0071555 cell wall organization No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|685900
MAHLSICLAFCLLLLEVVLAASRTSPPAGALVVRARTSNSGEFSTVSAAVASLPNDSSARTIFIYPGTYNEQVFI
TRSGPLTIYGYTTDTSTYRNNQVNIQAGVPASQAGSNDASGTLRVHKDNFKLYNVNVKNTFGPGSQAIAISQYGS
RVGLYACGFYGYQDTLYANEGTQVYLRGYIEGAVDFIFGRHASAYYGGNTIAIKGAGWVTASGRESDDGGSYVFN
QNTITIASGASGESGKVYFGRPWGNYAKVIFKNTIVEAPFNKALWSEWNDGDARTDHVFVADYNSSGSGVSGASR
PSWVTQLSSSQANQYSISSAVGSDYASWVDMDYFV*
Coding >Agabi119p4|685900
ATGGCTCACCTATCCATCTGCTTGGCTTTCTGTCTATTGCTTCTTGAAGTTGTTCTTGCTGCTTCCCGCACTTCA
CCTCCTGCAGGAGCCCTTGTTGTGAGAGCTCGAACGAGCAACTCTGGGGAATTTTCAACTGTTTCTGCAGCAGTT
GCCTCTCTTCCGAACGATAGCAGCGCTCGGACCATTTTCATATACCCTGGAACTTATAACGAGCAAGTTTTTATT
ACTCGTTCTGGACCTTTGACGATCTACGGATATACGACCGATACCTCCACTTATCGCAACAACCAAGTCAACATC
CAAGCAGGTGTTCCTGCTAGCCAAGCCGGATCAAACGATGCGAGTGGTACGCTTCGCGTTCACAAGGATAACTTC
AAGCTCTACAATGTCAATGTGAAGAACACCTTCGGCCCGGGCAGTCAGGCTATCGCCATCAGTCAATATGGAAGT
CGTGTTGGTCTTTACGCTTGTGGATTCTACGGATATCAGGATACTCTTTATGCAAACGAGGGAACCCAAGTTTAT
CTTCGAGGATACATTGAGGGGGCAGTCGATTTTATCTTCGGAAGACACGCTTCTGCATACTACGGCGGGAATACC
ATTGCAATCAAAGGTGCCGGATGGGTGACCGCAAGTGGTCGCGAGTCAGATGACGGAGGAAGTTATGTCTTCAAC
CAGAACACGATTACAATCGCGTCAGGCGCTTCTGGTGAATCAGGGAAAGTCTATTTCGGAAGACCATGGGGCAAC
TATGCCAAGGTCATCTTCAAAAACACAATCGTGGAAGCTCCATTCAATAAGGCCCTCTGGTCAGAATGGAACGAT
GGAGACGCTCGAACTGATCACGTCTTCGTGGCCGATTACAACAGTTCTGGGAGTGGCGTCAGTGGCGCAAGTCGC
CCAAGCTGGGTTACCCAACTCTCGTCCTCTCAAGCGAATCAGTATTCTATCTCCAGTGCCGTTGGAAGCGATTAT
GCTAGTTGGGTAGATATGGATTACTTTGTCTAA
Transcript >Agabi119p4|685900
ATGGCTCACCTATCCATCTGCTTGGCTTTCTGTCTATTGCTTCTTGAAGTTGTTCTTGCTGCTTCCCGCACTTCA
CCTCCTGCAGGAGCCCTTGTTGTGAGAGCTCGAACGAGCAACTCTGGGGAATTTTCAACTGTTTCTGCAGCAGTT
GCCTCTCTTCCGAACGATAGCAGCGCTCGGACCATTTTCATATACCCTGGAACTTATAACGAGCAAGTTTTTATT
ACTCGTTCTGGACCTTTGACGATCTACGGATATACGACCGATACCTCCACTTATCGCAACAACCAAGTCAACATC
CAAGCAGGTGTTCCTGCTAGCCAAGCCGGATCAAACGATGCGAGTGGTACGCTTCGCGTTCACAAGGATAACTTC
AAGCTCTACAATGTCAATGTGAAGAACACCTTCGGCCCGGGCAGTCAGGCTATCGCCATCAGTCAATATGGAAGT
CGTGTTGGTCTTTACGCTTGTGGATTCTACGGATATCAGGATACTCTTTATGCAAACGAGGGAACCCAAGTTTAT
CTTCGAGGATACATTGAGGGGGCAGTCGATTTTATCTTCGGAAGACACGCTTCTGCATACTACGGCGGGAATACC
ATTGCAATCAAAGGTGCCGGATGGGTGACCGCAAGTGGTCGCGAGTCAGATGACGGAGGAAGTTATGTCTTCAAC
CAGAACACGATTACAATCGCGTCAGGCGCTTCTGGTGAATCAGGGAAAGTCTATTTCGGAAGACCATGGGGCAAC
TATGCCAAGGTCATCTTCAAAAACACAATCGTGGAAGCTCCATTCAATAAGGCCCTCTGGTCAGAATGGAACGAT
GGAGACGCTCGAACTGATCACGTCTTCGTGGCCGATTACAACAGTTCTGGGAGTGGCGTCAGTGGCGCAAGTCGC
CCAAGCTGGGTTACCCAACTCTCGTCCTCTCAAGCGAATCAGTATTCTATCTCCAGTGCCGTTGGAAGCGATTAT
GCTAGTTGGGTAGATATGGATTACTTTGTCTAA
Gene >Agabi119p4|685900
ATGGCTCACCTATCCATCTGCTTGGCTTTCTGTCTATTGCTTCTTGAAGTTGTTCTTGCTGCTTCCCGCACTTCA
CCTCCTGCAGGAGCCCTTGTTGTGAGAGCTCGAACGAGCAACTCTGGGGAATTTTCAACTGTTTCTGCAGCAGTT
GCCTCTCTTCCGAACGATAGCAGCGCTCGGACCATTTTCATATACCCTGGAACTTATAACGAGCAAGTTTTTATT
ACTCGTTCTGGACCTTTGACGGTTGGTGTCTTTACTCAACGACAGTGCTGACGCTCGCTCAATGTTAAATATGAC
TTAGATCTACGGATATACGACCGATACCTCCACTTATCGCAACAACCAAGTCAACATCCAAGCAGGTGTTCCTGC
TAGCCAAGCCGGATCAAACGATGCGAGTGGTACGCTTCGCGTTCACAAGGATAACTTCAAGCTCTACAATGTCAA
TGTGAAGAACACCTTCGGCCCGGGCAGTCAGGCTATCGCCATCAGTCAATATGGAAGTCGTGTTGGTCTTTACGC
TTGTGGATTCTACGGATATCAGGATACTCTTTATGCAAACGAGGGAACCCAAGTTTATCTTCGAGGATACATTGA
GGTAAAGAAAAAGCTGTCAATCGCCAAGTATAACTTTCCACTGATCTTTTTTTTGACCAGGGGGCAGTCGATTTT
ATCTTCGGAAGACACGCTTCTGCATACTACGGCGGGAATACCATTGCAATCAAAGGTGCCGGATGGGTGACCGCA
AGTGGTCGCGAGTCAGATGACGGAGGAAGTTGTCAGTAAACGGTGGTTCTATCTTCTCCACATCGTCACTGACTG
ACATGCGAGCATCGCTACCTATAAGATGTCTTCAACCAGAACACGATTACAATCGCGTCAGGCGCTTCTGGTGAA
TCAGGGAAAGTCTATTTCGGAAGACCATGGGGCAGTAAGCCACGCCACATTTTCTCATGCACTTACAGCTTCTTA
CGAAAACCTACTTCCTTGTAGACTATGCCAAGTGACTTTTCCTTCTAAAAATATCATTCTAAAGCATAAGTGACA
TGTTTTATCACAGGGTCATCTTCAAAAACACAATCGTGGAAGCTCCATTCAATAAGGCCCTCTGGTCAGAATGGA
ACGATGGAGACGCTCGAACTGATCACGTCTTCGTGGCCGATTACAACAGTTCTGGGAGTGGCGTCAGTGGCGCAA
GTCGCCCAAGCTGGGTTACCCAACTCTCGTCCTCTCAAGCGAATCAGTATTCTATCTCCAGTGCCGTTGGAAGCG
ATTATGCTAGTTGGGTAGATATGGATTACTTTGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail