Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|683400
Gene name
Locationscaffold_07:1659449..1664390
Strand-
Gene length (bp)4941
Transcript length (bp)4941
Coding sequence length (bp)4941
Protein length (aa) 1647

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 1.4E-69 1167 1404
PF00665 rve Integrase core domain 7.4E-14 652 750
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 3.8E-11 69 199
PF13976 gag_pre-integrs GAG-pre-integrase domain 9.3E-08 590 639

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1128 1641 5.0E-119
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1124 1641 2.0E-85
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 427 853 6.0E-53
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1241 1550 4.0E-40
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 448 896 6.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1128 1641 5.0E-119
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1124 1641 2.0E-85
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 427 853 6.0E-53
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1241 1550 4.0E-40
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 448 896 6.0E-40
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 1177 1635 6.0E-32
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 1147 1635 6.0E-32
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 1147 1635 7.0E-32
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 1177 1635 1.0E-31
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 1177 1635 1.0E-31
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 1177 1635 1.0E-31
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 1177 1635 1.0E-31
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 1177 1635 1.0E-31
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1177 1635 2.0E-31
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 1177 1635 2.0E-31
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 1177 1635 2.0E-31
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 1177 1635 2.0E-31
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 1177 1635 2.0E-31
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1177 1635 2.0E-31
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 1177 1635 2.0E-31
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 1177 1635 2.0E-31
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 1177 1635 3.0E-31
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 1177 1635 3.0E-31
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 1177 1635 3.0E-31
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 1177 1635 3.0E-31
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 1177 1635 4.0E-31
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 1177 1635 5.0E-31
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 1147 1635 5.0E-31
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 1147 1635 7.0E-31
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 1177 1635 7.0E-31
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 1177 1635 8.0E-31
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 1147 1635 9.0E-31
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 1147 1635 1.0E-30
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 1147 1635 1.0E-30
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 1147 1635 2.0E-30
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 1177 1635 2.0E-30
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 1177 1635 2.0E-30
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 1177 1635 3.0E-30
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 1177 1635 3.0E-30
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 1177 1635 4.0E-30
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 1177 1635 5.0E-30
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 1177 1635 8.0E-30
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 1177 1635 1.0E-29
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 1177 1635 1.0E-29
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 1177 1635 2.0E-29
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 1177 1635 4.0E-29
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 1147 1635 5.0E-29
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 1177 1635 5.0E-29
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1327 1552 1.0E-25
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 1147 1646 8.0E-25
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1147 1646 1.0E-24
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 1177 1483 4.0E-21
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 1177 1400 2.0E-18
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 420 844 1.0E-13
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 420 795 3.0E-13
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 420 795 3.0E-13
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 420 795 3.0E-13
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 420 795 3.0E-13
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 445 795 3.0E-13
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 420 795 3.0E-13
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 420 795 3.0E-13
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 445 795 4.0E-13
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 445 795 4.0E-13
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 445 795 4.0E-13
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 445 795 5.0E-13
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 441 844 2.0E-12
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 441 844 3.0E-12
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 441 844 3.0E-12
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 1150 1231 3.0E-12
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 441 844 4.0E-12
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 441 844 6.0E-12
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 441 844 7.0E-12
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 441 844 7.0E-12
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 441 844 7.0E-12
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 441 844 7.0E-12
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 441 844 7.0E-12
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 441 844 8.0E-12
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 441 844 8.0E-12
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 441 844 8.0E-12
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 441 844 9.0E-12
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 441 844 9.0E-12
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 441 844 9.0E-12
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 761 846 9.0E-12
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 441 844 1.0E-11
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 441 844 1.0E-11
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 441 844 1.0E-11
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 441 844 1.0E-11
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 441 844 1.0E-11
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 441 844 2.0E-11
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 441 844 2.0E-11
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 441 844 2.0E-11
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 441 844 3.0E-11
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 441 844 3.0E-11
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 441 844 3.0E-11
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 441 844 3.0E-11
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 441 844 3.0E-11
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 441 844 3.0E-11
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 441 844 4.0E-11
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 441 844 5.0E-11
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 699 803 1.0E-10
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 699 803 1.0E-10
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 699 795 2.0E-10
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 631 844 3.0E-10
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 670 768 1.0E-06
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1434 1511 3.0E-06
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 12 278 6.0E-06
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 670 796 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006259 DNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup95
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|394200
Agaricus bisporus var bisporus H97 AgabiH97|079510
Agaricus bisporus var burnettii H119p4 Agabi119p4|584600
Agaricus bisporus var burnettii H119p4 Agabi119p4|598850
Agaricus bisporus var burnettii H119p4 Agabi119p4|620800
Agaricus bisporus var burnettii H119p4 Agabi119p4|683400 (this protein)
Agaricus bisporus var burnettii H119p4 Agabi119p4|685550
Agaricus bisporus var burnettii H119p4 Agabi119p4|707800
Agaricus bisporus var burnettii H119p4 Agabi119p4|710650
Agaricus bisporus var burnettii H119p4 Agabi119p4|711450
Agaricus bisporus var burnettii H119p4 Agabi119p4|742800
Agaricus bisporus var burnettii H119p4 Agabi119p4|758250
Agaricus bisporus var burnettii H119p4 Agabi119p4|758600

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|683400
MASAVLPLLNSVPVLTGADNYDSWKRNMRNILTLLQADGSSCSALDMCEDTATTTNDPAEVAKRAQVQKIAIAAI
NTCIAEGLISISYTSVRDLWVALENTYGTAGPAAIYSMYQQTLGFAISGNKDPSAEIANLEQLYNRLQSAGVDIP
ALVRAMTLLGSVPSSWNIASSFLAAKSSVNDVTYQNVRAAILTEFNQRRTSQAQANRFSGMRRGNQKPQWKSQDN
QQQQQQQQRQQQQQRPQGQQQQQRPQQQQQQPQGEQPKKKTRRGKRKNDNQNANEATTSGIEEYTAQSVTQFASP
ASLLHRISSPTRDPRPRPSPYPKPHPIGRFETAKARVWKQKGKEIEEKNAMEVDPIDEAITEHFSAPQDDDDAIS
LGSSASEYDWYVTSPCRSEINDAIQSCISNPLHVDRTCFNTFAYASPSYECDEPECKKCGKQPAHDTKYPTEWLL
DSGASCHFTSVLDDFIEHEMGNFGYVGTAEAGKVLPITARGTVMFEHEVANHRTGEVHVLTSTIAPVYYCKGMGG
RILSTNTFLQNGVTMSASENFTTLLDPSGSPILSAKRGIGCCKNNLHFVFCRIIKNSGHVNRSVQDPSYEIWHQR
FGHASDDALKRVPESSKTPVKIDFPRKKSTCPGCALGKQHQKTFSENPQRATHFGELIHSDLLEFPIQSYHKYKW
AITFLDDYSSAVSIALLRSKSQALKALKDFVALISTQHDAKVKRFRTDNGGEYVSQELEDFFKSKGIIHETTAPY
AHQQNGRAERLNRTLLDKIRAMMTNACIPESYWEFAIQTAVHVYNRTPMRRIGWKSPSELWYGVKPDVSRLRVFG
CGAYVFIPEEKRNNKLEPRSELMLFVGYTSGGANYLFIRHTKNNAEFVSPTAIFEETYFPKCPETDPRGYPRRAL
SVPNDDDNNSRDADPPSAPAPFGFGGDPSKPLPPTPPRARSPSIPSSGPSRPRTPSRPPSPQQEAPPPRVPQPGP
SEPRRSGRQRRAPLRPGNVYGDRSDPVEDLKNDFDDLLDKIRAQGEAERHPRERDVRRPYPPEGVVIGPQEERFR
RSFPYRERRAREYERRPRWNPGGAQPPVNPEVHPPSEPSQERSPNSDMGQSRDPMEDLQRIVHEGGLEFIEFLMA
NTVAKSKTPIQFKDLADLSPSDRKAWLDACLEELQALKKRGVYELIDLPKGRRAIKNRWVFNTKSDGRKRARLVA
KGFSQIEGVDFDELFSPVVRYETARLLLGVAALEDWEIESVDVKTAYLYGKLDEEIYMEQPEGFRLKGKENKVWR
LHRALYGLKQAGLAWWRELTTSMKELGFKRCESDAGVYYYCCPKTAQLIIALVYVDDVAILGKRTSLFKSLKDSF
MKKWECRDLGACKEFLGMSISRDRKNRKIYLDQVEYLDKVLEKFNVAAKPTKTPLASGFSFLPNSEPANPVFRQK
YQQLVGSLMYLMIGSRPDIAYAVVKLSQQCANPAPEHYEAGLYVLRYLLATRKYRMVFDGSSNEAIVAYSDSDWA
QDSTDRKSVTGNYVTLASGCVSWLSRRQKTVAASSTEAEYMALSDCSKQLVWMHQLLSEIGLSCPTPHLIGDNQG
SIFWASNPVQEKRSKHIDVKYHIVRQYVEDKKIELFWVDGTKNPADIFTKNLDKTKFERIRSLLGMEFFAQ*
Coding >Agabi119p4|683400
ATGGCCTCTGCTGTTCTCCCCCTCCTCAACTCTGTTCCGGTCCTCACTGGCGCCGATAATTATGACTCTTGGAAG
CGTAACATGAGGAACATCCTCACCTTGCTCCAAGCTGATGGGTCCAGTTGCTCTGCACTTGACATGTGCGAGGAC
ACTGCAACTACAACCAACGATCCTGCCGAAGTAGCCAAAAGGGCTCAAGTCCAAAAGATAGCGATTGCTGCGATA
AACACGTGCATTGCTGAGGGCTTGATCTCGATCTCGTATACCTCAGTACGCGACCTTTGGGTTGCCCTGGAAAAT
ACGTATGGTACTGCTGGCCCTGCCGCAATCTATTCAATGTACCAACAGACCCTAGGCTTCGCTATTTCTGGCAAC
AAGGATCCGTCAGCTGAGATCGCTAATCTCGAGCAGCTTTACAACCGCCTCCAGTCTGCCGGTGTTGACATTCCG
GCCCTCGTTCGAGCCATGACTCTTCTTGGCTCTGTTCCTTCTTCTTGGAACATCGCATCTTCTTTTCTTGCCGCC
AAGTCGTCGGTTAACGACGTTACTTATCAGAATGTGCGCGCCGCCATCTTGACTGAATTTAACCAGCGCCGCACT
TCTCAAGCGCAAGCTAATAGGTTTTCTGGCATGAGGCGTGGCAATCAAAAGCCACAATGGAAGTCGCAAGACAAC
CAGCAGCAGCAGCAGCAACAGCAACGACAACAGCAGCAGCAGCGACCGCAAGGTCAGCAGCAGCAGCAACGTCCA
CAGCAGCAGCAGCAGCAGCCTCAGGGTGAGCAGCCCAAAAAGAAAACTCGTCGCGGCAAACGTAAGAACGATAAT
CAGAATGCGAACGAGGCCACTACATCTGGCATCGAAGAGTACACGGCCCAATCCGTGACACAGTTCGCTTCCCCT
GCATCATTGCTTCATCGAATCTCTTCTCCAACTCGTGACCCTCGTCCGAGACCGAGCCCCTATCCGAAGCCTCAT
CCTATTGGGCGATTCGAAACTGCCAAGGCTCGGGTCTGGAAACAAAAAGGGAAGGAGATCGAAGAAAAGAACGCA
ATGGAAGTAGATCCCATCGATGAGGCGATCACTGAACATTTCAGCGCTCCTCAGGATGACGACGATGCGATCTCG
CTCGGTTCGTCCGCTTCTGAGTATGACTGGTATGTGACCTCACCTTGTAGAAGTGAAATTAATGACGCAATACAG
TCCTGCATCTCCAACCCTCTACATGTAGATCGGACTTGTTTTAATACATTTGCTTATGCGTCTCCTTCTTACGAG
TGTGATGAACCTGAGTGCAAAAAATGTGGGAAGCAGCCTGCTCATGACACTAAGTATCCAACTGAGTGGCTCCTC
GATTCTGGAGCGTCCTGCCACTTTACCAGTGTGTTGGATGACTTCATCGAGCACGAAATGGGAAATTTCGGATAT
GTAGGAACTGCTGAAGCGGGAAAGGTCCTTCCAATCACCGCTCGTGGAACCGTCATGTTTGAGCATGAAGTTGCG
AACCATCGAACTGGTGAAGTCCATGTCTTGACTTCGACAATTGCTCCTGTCTATTATTGCAAGGGCATGGGGGGC
CGCATTCTGTCCACCAACACGTTTCTGCAAAACGGTGTGACAATGTCTGCCTCTGAGAACTTTACTACGCTCCTC
GATCCCTCAGGATCTCCCATCCTTTCAGCCAAACGAGGCATAGGATGTTGCAAAAATAATCTCCACTTCGTGTTC
TGTCGGATTATTAAAAACTCCGGACATGTGAACCGATCAGTCCAAGATCCATCTTATGAGATCTGGCACCAGAGA
TTTGGGCATGCATCGGATGACGCCCTGAAAAGGGTACCTGAATCTTCGAAAACACCTGTGAAAATCGATTTCCCT
CGGAAGAAATCTACGTGTCCTGGGTGCGCTCTTGGTAAGCAGCACCAGAAGACTTTCTCCGAGAATCCCCAAAGG
GCAACTCATTTTGGAGAATTGATTCATTCTGATCTTCTCGAATTCCCGATCCAATCGTACCATAAATACAAATGG
GCGATAACATTCCTTGATGATTATTCATCAGCCGTCTCCATCGCATTATTGCGTTCGAAATCGCAGGCACTAAAA
GCTCTGAAGGACTTTGTTGCTTTGATTAGCACCCAACATGATGCTAAGGTGAAGCGTTTCAGAACCGACAATGGC
GGCGAATATGTATCTCAGGAATTAGAAGACTTCTTTAAGTCAAAGGGGATAATCCATGAAACAACCGCACCTTAC
GCGCACCAACAGAACGGTCGCGCTGAGAGATTGAATCGCACCTTACTCGATAAGATAAGGGCCATGATGACAAAT
GCGTGCATTCCCGAGTCATACTGGGAATTTGCGATTCAAACGGCTGTGCATGTCTATAATCGCACGCCGATGCGA
CGGATTGGATGGAAATCACCATCTGAGTTATGGTACGGTGTAAAACCGGATGTCTCTCGACTCCGTGTTTTTGGC
TGTGGGGCATATGTCTTTATCCCAGAGGAGAAACGTAACAACAAACTTGAGCCTCGTTCTGAGTTAATGCTCTTT
GTTGGTTACACTTCTGGAGGAGCAAACTATCTATTCATCAGGCACACCAAAAATAATGCCGAGTTTGTTTCTCCT
ACAGCCATTTTCGAAGAAACATATTTCCCGAAATGTCCCGAGACTGATCCTAGAGGATATCCGAGACGAGCTCTG
TCAGTCCCTAATGATGACGATAACAACTCACGAGATGCGGATCCACCCTCCGCTCCAGCTCCATTTGGGTTTGGT
GGCGACCCTAGTAAGCCACTCCCACCTACTCCACCTAGGGCTCGATCACCCTCCATTCCGAGTTCCGGCCCTTCG
AGACCGAGAACCCCATCTAGACCACCTTCACCACAGCAAGAAGCACCTCCGCCTCGTGTTCCTCAGCCTGGTCCG
AGTGAACCACGGAGATCTGGTAGACAACGCCGTGCTCCACTGCGTCCTGGTAACGTTTACGGTGATCGATCTGAT
CCAGTTGAGGATCTCAAAAATGACTTTGATGATCTCCTCGATAAGATTCGAGCACAGGGTGAAGCTGAACGACAC
CCCCGTGAACGTGATGTCCGACGTCCATACCCTCCTGAAGGAGTGGTAATAGGGCCGCAAGAAGAGCGCTTTCGT
CGCTCCTTCCCCTATAGAGAACGTCGTGCCAGAGAATATGAAAGGCGTCCACGATGGAATCCTGGAGGAGCACAG
CCCCCAGTCAACCCTGAAGTACATCCTCCGAGCGAACCTTCCCAGGAACGCTCTCCAAATTCAGATATGGGACAA
TCTAGAGATCCCATGGAGGACTTACAACGTATTGTCCATGAGGGGGGACTGGAATTTATCGAATTCTTAATGGCC
AATACCGTCGCCAAGTCCAAAACACCAATCCAATTCAAAGACTTAGCTGATCTATCTCCATCTGATCGCAAAGCT
TGGCTTGACGCATGCCTTGAAGAGCTCCAAGCTCTTAAGAAACGTGGAGTATATGAATTGATTGATCTCCCAAAA
GGTCGTAGAGCAATCAAAAATAGATGGGTATTTAACACGAAGTCTGATGGCCGGAAACGTGCTCGACTCGTGGCT
AAAGGTTTCTCCCAGATCGAAGGAGTTGACTTCGATGAGTTATTTTCTCCCGTAGTCCGTTATGAAACGGCACGC
CTCCTACTCGGTGTTGCAGCACTTGAGGATTGGGAGATTGAGAGCGTGGATGTAAAAACAGCATATCTCTACGGT
AAACTGGATGAAGAAATCTACATGGAGCAGCCTGAAGGCTTTCGCCTGAAAGGCAAAGAAAATAAAGTGTGGAGA
TTACACCGAGCTCTTTACGGCCTGAAACAAGCTGGCTTGGCCTGGTGGCGTGAACTGACCACGTCCATGAAGGAA
CTAGGCTTTAAGCGCTGTGAATCAGATGCCGGTGTCTATTATTATTGCTGCCCAAAAACGGCGCAACTTATCATA
GCACTTGTCTATGTTGACGATGTTGCTATCCTTGGCAAACGGACTTCGCTCTTCAAGAGTTTGAAGGACTCCTTC
ATGAAGAAGTGGGAATGTCGCGATCTTGGAGCATGCAAAGAGTTCTTAGGAATGAGCATCTCTCGCGACAGGAAG
AACCGGAAAATATACCTTGACCAGGTCGAGTATCTCGATAAGGTCCTCGAGAAATTCAACGTTGCTGCAAAGCCG
ACGAAGACTCCTCTCGCGTCCGGGTTCTCCTTCCTTCCAAATTCTGAACCGGCTAATCCAGTGTTTCGCCAAAAA
TACCAACAACTTGTGGGGTCTTTGATGTATCTGATGATCGGTTCCCGACCAGACATCGCTTACGCCGTTGTTAAG
CTGAGCCAACAGTGTGCAAACCCTGCACCTGAACACTATGAGGCAGGACTCTATGTTCTTCGATACCTCCTAGCT
ACGCGCAAGTACAGAATGGTGTTTGACGGGTCGTCGAATGAGGCAATTGTTGCTTACTCCGACTCTGATTGGGCT
CAAGATTCCACTGACCGCAAATCTGTCACAGGTAACTATGTGACTCTTGCTTCTGGATGTGTTTCCTGGTTGAGC
AGACGTCAAAAGACTGTGGCCGCTTCTTCGACTGAGGCCGAATATATGGCGCTGTCAGATTGCTCTAAACAGCTT
GTTTGGATGCACCAGCTGCTATCGGAAATAGGACTTAGTTGTCCAACTCCTCATTTGATTGGCGACAATCAAGGG
TCCATTTTCTGGGCATCTAACCCTGTCCAAGAAAAACGCTCAAAGCACATTGACGTGAAATATCACATAGTCCGT
CAATATGTCGAGGACAAAAAGATTGAATTATTTTGGGTTGATGGCACCAAGAATCCTGCTGACATCTTCACCAAA
AATCTCGACAAAACTAAATTCGAGCGTATTCGATCCCTACTAGGTATGGAATTCTTTGCGCAGTAA
Transcript >Agabi119p4|683400
ATGGCCTCTGCTGTTCTCCCCCTCCTCAACTCTGTTCCGGTCCTCACTGGCGCCGATAATTATGACTCTTGGAAG
CGTAACATGAGGAACATCCTCACCTTGCTCCAAGCTGATGGGTCCAGTTGCTCTGCACTTGACATGTGCGAGGAC
ACTGCAACTACAACCAACGATCCTGCCGAAGTAGCCAAAAGGGCTCAAGTCCAAAAGATAGCGATTGCTGCGATA
AACACGTGCATTGCTGAGGGCTTGATCTCGATCTCGTATACCTCAGTACGCGACCTTTGGGTTGCCCTGGAAAAT
ACGTATGGTACTGCTGGCCCTGCCGCAATCTATTCAATGTACCAACAGACCCTAGGCTTCGCTATTTCTGGCAAC
AAGGATCCGTCAGCTGAGATCGCTAATCTCGAGCAGCTTTACAACCGCCTCCAGTCTGCCGGTGTTGACATTCCG
GCCCTCGTTCGAGCCATGACTCTTCTTGGCTCTGTTCCTTCTTCTTGGAACATCGCATCTTCTTTTCTTGCCGCC
AAGTCGTCGGTTAACGACGTTACTTATCAGAATGTGCGCGCCGCCATCTTGACTGAATTTAACCAGCGCCGCACT
TCTCAAGCGCAAGCTAATAGGTTTTCTGGCATGAGGCGTGGCAATCAAAAGCCACAATGGAAGTCGCAAGACAAC
CAGCAGCAGCAGCAGCAACAGCAACGACAACAGCAGCAGCAGCGACCGCAAGGTCAGCAGCAGCAGCAACGTCCA
CAGCAGCAGCAGCAGCAGCCTCAGGGTGAGCAGCCCAAAAAGAAAACTCGTCGCGGCAAACGTAAGAACGATAAT
CAGAATGCGAACGAGGCCACTACATCTGGCATCGAAGAGTACACGGCCCAATCCGTGACACAGTTCGCTTCCCCT
GCATCATTGCTTCATCGAATCTCTTCTCCAACTCGTGACCCTCGTCCGAGACCGAGCCCCTATCCGAAGCCTCAT
CCTATTGGGCGATTCGAAACTGCCAAGGCTCGGGTCTGGAAACAAAAAGGGAAGGAGATCGAAGAAAAGAACGCA
ATGGAAGTAGATCCCATCGATGAGGCGATCACTGAACATTTCAGCGCTCCTCAGGATGACGACGATGCGATCTCG
CTCGGTTCGTCCGCTTCTGAGTATGACTGGTATGTGACCTCACCTTGTAGAAGTGAAATTAATGACGCAATACAG
TCCTGCATCTCCAACCCTCTACATGTAGATCGGACTTGTTTTAATACATTTGCTTATGCGTCTCCTTCTTACGAG
TGTGATGAACCTGAGTGCAAAAAATGTGGGAAGCAGCCTGCTCATGACACTAAGTATCCAACTGAGTGGCTCCTC
GATTCTGGAGCGTCCTGCCACTTTACCAGTGTGTTGGATGACTTCATCGAGCACGAAATGGGAAATTTCGGATAT
GTAGGAACTGCTGAAGCGGGAAAGGTCCTTCCAATCACCGCTCGTGGAACCGTCATGTTTGAGCATGAAGTTGCG
AACCATCGAACTGGTGAAGTCCATGTCTTGACTTCGACAATTGCTCCTGTCTATTATTGCAAGGGCATGGGGGGC
CGCATTCTGTCCACCAACACGTTTCTGCAAAACGGTGTGACAATGTCTGCCTCTGAGAACTTTACTACGCTCCTC
GATCCCTCAGGATCTCCCATCCTTTCAGCCAAACGAGGCATAGGATGTTGCAAAAATAATCTCCACTTCGTGTTC
TGTCGGATTATTAAAAACTCCGGACATGTGAACCGATCAGTCCAAGATCCATCTTATGAGATCTGGCACCAGAGA
TTTGGGCATGCATCGGATGACGCCCTGAAAAGGGTACCTGAATCTTCGAAAACACCTGTGAAAATCGATTTCCCT
CGGAAGAAATCTACGTGTCCTGGGTGCGCTCTTGGTAAGCAGCACCAGAAGACTTTCTCCGAGAATCCCCAAAGG
GCAACTCATTTTGGAGAATTGATTCATTCTGATCTTCTCGAATTCCCGATCCAATCGTACCATAAATACAAATGG
GCGATAACATTCCTTGATGATTATTCATCAGCCGTCTCCATCGCATTATTGCGTTCGAAATCGCAGGCACTAAAA
GCTCTGAAGGACTTTGTTGCTTTGATTAGCACCCAACATGATGCTAAGGTGAAGCGTTTCAGAACCGACAATGGC
GGCGAATATGTATCTCAGGAATTAGAAGACTTCTTTAAGTCAAAGGGGATAATCCATGAAACAACCGCACCTTAC
GCGCACCAACAGAACGGTCGCGCTGAGAGATTGAATCGCACCTTACTCGATAAGATAAGGGCCATGATGACAAAT
GCGTGCATTCCCGAGTCATACTGGGAATTTGCGATTCAAACGGCTGTGCATGTCTATAATCGCACGCCGATGCGA
CGGATTGGATGGAAATCACCATCTGAGTTATGGTACGGTGTAAAACCGGATGTCTCTCGACTCCGTGTTTTTGGC
TGTGGGGCATATGTCTTTATCCCAGAGGAGAAACGTAACAACAAACTTGAGCCTCGTTCTGAGTTAATGCTCTTT
GTTGGTTACACTTCTGGAGGAGCAAACTATCTATTCATCAGGCACACCAAAAATAATGCCGAGTTTGTTTCTCCT
ACAGCCATTTTCGAAGAAACATATTTCCCGAAATGTCCCGAGACTGATCCTAGAGGATATCCGAGACGAGCTCTG
TCAGTCCCTAATGATGACGATAACAACTCACGAGATGCGGATCCACCCTCCGCTCCAGCTCCATTTGGGTTTGGT
GGCGACCCTAGTAAGCCACTCCCACCTACTCCACCTAGGGCTCGATCACCCTCCATTCCGAGTTCCGGCCCTTCG
AGACCGAGAACCCCATCTAGACCACCTTCACCACAGCAAGAAGCACCTCCGCCTCGTGTTCCTCAGCCTGGTCCG
AGTGAACCACGGAGATCTGGTAGACAACGCCGTGCTCCACTGCGTCCTGGTAACGTTTACGGTGATCGATCTGAT
CCAGTTGAGGATCTCAAAAATGACTTTGATGATCTCCTCGATAAGATTCGAGCACAGGGTGAAGCTGAACGACAC
CCCCGTGAACGTGATGTCCGACGTCCATACCCTCCTGAAGGAGTGGTAATAGGGCCGCAAGAAGAGCGCTTTCGT
CGCTCCTTCCCCTATAGAGAACGTCGTGCCAGAGAATATGAAAGGCGTCCACGATGGAATCCTGGAGGAGCACAG
CCCCCAGTCAACCCTGAAGTACATCCTCCGAGCGAACCTTCCCAGGAACGCTCTCCAAATTCAGATATGGGACAA
TCTAGAGATCCCATGGAGGACTTACAACGTATTGTCCATGAGGGGGGACTGGAATTTATCGAATTCTTAATGGCC
AATACCGTCGCCAAGTCCAAAACACCAATCCAATTCAAAGACTTAGCTGATCTATCTCCATCTGATCGCAAAGCT
TGGCTTGACGCATGCCTTGAAGAGCTCCAAGCTCTTAAGAAACGTGGAGTATATGAATTGATTGATCTCCCAAAA
GGTCGTAGAGCAATCAAAAATAGATGGGTATTTAACACGAAGTCTGATGGCCGGAAACGTGCTCGACTCGTGGCT
AAAGGTTTCTCCCAGATCGAAGGAGTTGACTTCGATGAGTTATTTTCTCCCGTAGTCCGTTATGAAACGGCACGC
CTCCTACTCGGTGTTGCAGCACTTGAGGATTGGGAGATTGAGAGCGTGGATGTAAAAACAGCATATCTCTACGGT
AAACTGGATGAAGAAATCTACATGGAGCAGCCTGAAGGCTTTCGCCTGAAAGGCAAAGAAAATAAAGTGTGGAGA
TTACACCGAGCTCTTTACGGCCTGAAACAAGCTGGCTTGGCCTGGTGGCGTGAACTGACCACGTCCATGAAGGAA
CTAGGCTTTAAGCGCTGTGAATCAGATGCCGGTGTCTATTATTATTGCTGCCCAAAAACGGCGCAACTTATCATA
GCACTTGTCTATGTTGACGATGTTGCTATCCTTGGCAAACGGACTTCGCTCTTCAAGAGTTTGAAGGACTCCTTC
ATGAAGAAGTGGGAATGTCGCGATCTTGGAGCATGCAAAGAGTTCTTAGGAATGAGCATCTCTCGCGACAGGAAG
AACCGGAAAATATACCTTGACCAGGTCGAGTATCTCGATAAGGTCCTCGAGAAATTCAACGTTGCTGCAAAGCCG
ACGAAGACTCCTCTCGCGTCCGGGTTCTCCTTCCTTCCAAATTCTGAACCGGCTAATCCAGTGTTTCGCCAAAAA
TACCAACAACTTGTGGGGTCTTTGATGTATCTGATGATCGGTTCCCGACCAGACATCGCTTACGCCGTTGTTAAG
CTGAGCCAACAGTGTGCAAACCCTGCACCTGAACACTATGAGGCAGGACTCTATGTTCTTCGATACCTCCTAGCT
ACGCGCAAGTACAGAATGGTGTTTGACGGGTCGTCGAATGAGGCAATTGTTGCTTACTCCGACTCTGATTGGGCT
CAAGATTCCACTGACCGCAAATCTGTCACAGGTAACTATGTGACTCTTGCTTCTGGATGTGTTTCCTGGTTGAGC
AGACGTCAAAAGACTGTGGCCGCTTCTTCGACTGAGGCCGAATATATGGCGCTGTCAGATTGCTCTAAACAGCTT
GTTTGGATGCACCAGCTGCTATCGGAAATAGGACTTAGTTGTCCAACTCCTCATTTGATTGGCGACAATCAAGGG
TCCATTTTCTGGGCATCTAACCCTGTCCAAGAAAAACGCTCAAAGCACATTGACGTGAAATATCACATAGTCCGT
CAATATGTCGAGGACAAAAAGATTGAATTATTTTGGGTTGATGGCACCAAGAATCCTGCTGACATCTTCACCAAA
AATCTCGACAAAACTAAATTCGAGCGTATTCGATCCCTACTAGGTATGGAATTCTTTGCGCAGTAA
Gene >Agabi119p4|683400
ATGGCCTCTGCTGTTCTCCCCCTCCTCAACTCTGTTCCGGTCCTCACTGGCGCCGATAATTATGACTCTTGGAAG
CGTAACATGAGGAACATCCTCACCTTGCTCCAAGCTGATGGGTCCAGTTGCTCTGCACTTGACATGTGCGAGGAC
ACTGCAACTACAACCAACGATCCTGCCGAAGTAGCCAAAAGGGCTCAAGTCCAAAAGATAGCGATTGCTGCGATA
AACACGTGCATTGCTGAGGGCTTGATCTCGATCTCGTATACCTCAGTACGCGACCTTTGGGTTGCCCTGGAAAAT
ACGTATGGTACTGCTGGCCCTGCCGCAATCTATTCAATGTACCAACAGACCCTAGGCTTCGCTATTTCTGGCAAC
AAGGATCCGTCAGCTGAGATCGCTAATCTCGAGCAGCTTTACAACCGCCTCCAGTCTGCCGGTGTTGACATTCCG
GCCCTCGTTCGAGCCATGACTCTTCTTGGCTCTGTTCCTTCTTCTTGGAACATCGCATCTTCTTTTCTTGCCGCC
AAGTCGTCGGTTAACGACGTTACTTATCAGAATGTGCGCGCCGCCATCTTGACTGAATTTAACCAGCGCCGCACT
TCTCAAGCGCAAGCTAATAGGTTTTCTGGCATGAGGCGTGGCAATCAAAAGCCACAATGGAAGTCGCAAGACAAC
CAGCAGCAGCAGCAGCAACAGCAACGACAACAGCAGCAGCAGCGACCGCAAGGTCAGCAGCAGCAGCAACGTCCA
CAGCAGCAGCAGCAGCAGCCTCAGGGTGAGCAGCCCAAAAAGAAAACTCGTCGCGGCAAACGTAAGAACGATAAT
CAGAATGCGAACGAGGCCACTACATCTGGCATCGAAGAGTACACGGCCCAATCCGTGACACAGTTCGCTTCCCCT
GCATCATTGCTTCATCGAATCTCTTCTCCAACTCGTGACCCTCGTCCGAGACCGAGCCCCTATCCGAAGCCTCAT
CCTATTGGGCGATTCGAAACTGCCAAGGCTCGGGTCTGGAAACAAAAAGGGAAGGAGATCGAAGAAAAGAACGCA
ATGGAAGTAGATCCCATCGATGAGGCGATCACTGAACATTTCAGCGCTCCTCAGGATGACGACGATGCGATCTCG
CTCGGTTCGTCCGCTTCTGAGTATGACTGGTATGTGACCTCACCTTGTAGAAGTGAAATTAATGACGCAATACAG
TCCTGCATCTCCAACCCTCTACATGTAGATCGGACTTGTTTTAATACATTTGCTTATGCGTCTCCTTCTTACGAG
TGTGATGAACCTGAGTGCAAAAAATGTGGGAAGCAGCCTGCTCATGACACTAAGTATCCAACTGAGTGGCTCCTC
GATTCTGGAGCGTCCTGCCACTTTACCAGTGTGTTGGATGACTTCATCGAGCACGAAATGGGAAATTTCGGATAT
GTAGGAACTGCTGAAGCGGGAAAGGTCCTTCCAATCACCGCTCGTGGAACCGTCATGTTTGAGCATGAAGTTGCG
AACCATCGAACTGGTGAAGTCCATGTCTTGACTTCGACAATTGCTCCTGTCTATTATTGCAAGGGCATGGGGGGC
CGCATTCTGTCCACCAACACGTTTCTGCAAAACGGTGTGACAATGTCTGCCTCTGAGAACTTTACTACGCTCCTC
GATCCCTCAGGATCTCCCATCCTTTCAGCCAAACGAGGCATAGGATGTTGCAAAAATAATCTCCACTTCGTGTTC
TGTCGGATTATTAAAAACTCCGGACATGTGAACCGATCAGTCCAAGATCCATCTTATGAGATCTGGCACCAGAGA
TTTGGGCATGCATCGGATGACGCCCTGAAAAGGGTACCTGAATCTTCGAAAACACCTGTGAAAATCGATTTCCCT
CGGAAGAAATCTACGTGTCCTGGGTGCGCTCTTGGTAAGCAGCACCAGAAGACTTTCTCCGAGAATCCCCAAAGG
GCAACTCATTTTGGAGAATTGATTCATTCTGATCTTCTCGAATTCCCGATCCAATCGTACCATAAATACAAATGG
GCGATAACATTCCTTGATGATTATTCATCAGCCGTCTCCATCGCATTATTGCGTTCGAAATCGCAGGCACTAAAA
GCTCTGAAGGACTTTGTTGCTTTGATTAGCACCCAACATGATGCTAAGGTGAAGCGTTTCAGAACCGACAATGGC
GGCGAATATGTATCTCAGGAATTAGAAGACTTCTTTAAGTCAAAGGGGATAATCCATGAAACAACCGCACCTTAC
GCGCACCAACAGAACGGTCGCGCTGAGAGATTGAATCGCACCTTACTCGATAAGATAAGGGCCATGATGACAAAT
GCGTGCATTCCCGAGTCATACTGGGAATTTGCGATTCAAACGGCTGTGCATGTCTATAATCGCACGCCGATGCGA
CGGATTGGATGGAAATCACCATCTGAGTTATGGTACGGTGTAAAACCGGATGTCTCTCGACTCCGTGTTTTTGGC
TGTGGGGCATATGTCTTTATCCCAGAGGAGAAACGTAACAACAAACTTGAGCCTCGTTCTGAGTTAATGCTCTTT
GTTGGTTACACTTCTGGAGGAGCAAACTATCTATTCATCAGGCACACCAAAAATAATGCCGAGTTTGTTTCTCCT
ACAGCCATTTTCGAAGAAACATATTTCCCGAAATGTCCCGAGACTGATCCTAGAGGATATCCGAGACGAGCTCTG
TCAGTCCCTAATGATGACGATAACAACTCACGAGATGCGGATCCACCCTCCGCTCCAGCTCCATTTGGGTTTGGT
GGCGACCCTAGTAAGCCACTCCCACCTACTCCACCTAGGGCTCGATCACCCTCCATTCCGAGTTCCGGCCCTTCG
AGACCGAGAACCCCATCTAGACCACCTTCACCACAGCAAGAAGCACCTCCGCCTCGTGTTCCTCAGCCTGGTCCG
AGTGAACCACGGAGATCTGGTAGACAACGCCGTGCTCCACTGCGTCCTGGTAACGTTTACGGTGATCGATCTGAT
CCAGTTGAGGATCTCAAAAATGACTTTGATGATCTCCTCGATAAGATTCGAGCACAGGGTGAAGCTGAACGACAC
CCCCGTGAACGTGATGTCCGACGTCCATACCCTCCTGAAGGAGTGGTAATAGGGCCGCAAGAAGAGCGCTTTCGT
CGCTCCTTCCCCTATAGAGAACGTCGTGCCAGAGAATATGAAAGGCGTCCACGATGGAATCCTGGAGGAGCACAG
CCCCCAGTCAACCCTGAAGTACATCCTCCGAGCGAACCTTCCCAGGAACGCTCTCCAAATTCAGATATGGGACAA
TCTAGAGATCCCATGGAGGACTTACAACGTATTGTCCATGAGGGGGGACTGGAATTTATCGAATTCTTAATGGCC
AATACCGTCGCCAAGTCCAAAACACCAATCCAATTCAAAGACTTAGCTGATCTATCTCCATCTGATCGCAAAGCT
TGGCTTGACGCATGCCTTGAAGAGCTCCAAGCTCTTAAGAAACGTGGAGTATATGAATTGATTGATCTCCCAAAA
GGTCGTAGAGCAATCAAAAATAGATGGGTATTTAACACGAAGTCTGATGGCCGGAAACGTGCTCGACTCGTGGCT
AAAGGTTTCTCCCAGATCGAAGGAGTTGACTTCGATGAGTTATTTTCTCCCGTAGTCCGTTATGAAACGGCACGC
CTCCTACTCGGTGTTGCAGCACTTGAGGATTGGGAGATTGAGAGCGTGGATGTAAAAACAGCATATCTCTACGGT
AAACTGGATGAAGAAATCTACATGGAGCAGCCTGAAGGCTTTCGCCTGAAAGGCAAAGAAAATAAAGTGTGGAGA
TTACACCGAGCTCTTTACGGCCTGAAACAAGCTGGCTTGGCCTGGTGGCGTGAACTGACCACGTCCATGAAGGAA
CTAGGCTTTAAGCGCTGTGAATCAGATGCCGGTGTCTATTATTATTGCTGCCCAAAAACGGCGCAACTTATCATA
GCACTTGTCTATGTTGACGATGTTGCTATCCTTGGCAAACGGACTTCGCTCTTCAAGAGTTTGAAGGACTCCTTC
ATGAAGAAGTGGGAATGTCGCGATCTTGGAGCATGCAAAGAGTTCTTAGGAATGAGCATCTCTCGCGACAGGAAG
AACCGGAAAATATACCTTGACCAGGTCGAGTATCTCGATAAGGTCCTCGAGAAATTCAACGTTGCTGCAAAGCCG
ACGAAGACTCCTCTCGCGTCCGGGTTCTCCTTCCTTCCAAATTCTGAACCGGCTAATCCAGTGTTTCGCCAAAAA
TACCAACAACTTGTGGGGTCTTTGATGTATCTGATGATCGGTTCCCGACCAGACATCGCTTACGCCGTTGTTAAG
CTGAGCCAACAGTGTGCAAACCCTGCACCTGAACACTATGAGGCAGGACTCTATGTTCTTCGATACCTCCTAGCT
ACGCGCAAGTACAGAATGGTGTTTGACGGGTCGTCGAATGAGGCAATTGTTGCTTACTCCGACTCTGATTGGGCT
CAAGATTCCACTGACCGCAAATCTGTCACAGGTAACTATGTGACTCTTGCTTCTGGATGTGTTTCCTGGTTGAGC
AGACGTCAAAAGACTGTGGCCGCTTCTTCGACTGAGGCCGAATATATGGCGCTGTCAGATTGCTCTAAACAGCTT
GTTTGGATGCACCAGCTGCTATCGGAAATAGGACTTAGTTGTCCAACTCCTCATTTGATTGGCGACAATCAAGGG
TCCATTTTCTGGGCATCTAACCCTGTCCAAGAAAAACGCTCAAAGCACATTGACGTGAAATATCACATAGTCCGT
CAATATGTCGAGGACAAAAAGATTGAATTATTTTGGGTTGATGGCACCAAGAATCCTGCTGACATCTTCACCAAA
AATCTCGACAAAACTAAATTCGAGCGTATTCGATCCCTACTAGGTATGGAATTCTTTGCGCAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail