Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|682800
Gene name
Locationscaffold_07:1522938..1524002
Strand+
Gene length (bp)1064
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 2.5E-11 19 224

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0DKJ6|GDL4_ARATH GDSL esterase/lipase At1g20120 OS=Arabidopsis thaliana GN=At1g20120 PE=2 SV=1 46 229 2.0E-09
sp|P40602|APG_ARATH Anther-specific proline-rich protein APG OS=Arabidopsis thaliana GN=APG PE=2 SV=2 87 224 2.0E-07
sp|P40603|APG_BRANA Anther-specific proline-rich protein APG (Fragment) OS=Brassica napus GN=APG PE=2 SV=1 89 219 5.0E-07

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|682800
MYIYKLEFLTGCFQGSPFNCPKQLWNFAFAGADIDGDILPLHHDFTIPLVDQVTQWLKFASTVIPHPENETLTSW
WIGINDTGDSHHNTSITDFTAFWEIEMQSYFKAVDLASRHGLKAHLFLNVPPGERSPGSSGNPGLLKDHIQLFNS
ILVNHIDQFTKTHPDNVVITFDTHTWFNQILDHPEKYGFQNVTGFCTCVDPSGYFWYDSGHPTQHVHQLLAEAIQ
HGLGG*
Coding >Agabi119p4|682800
ATGTATATATACAAGCTCGAATTCCTCACAGGATGCTTCCAAGGCAGTCCCTTCAATTGCCCTAAACAACTTTGG
AATTTCGCATTTGCAGGCGCAGACATCGACGGGGATATACTTCCCCTACACCATGACTTCACCATTCCATTAGTC
GACCAAGTTACTCAATGGCTAAAATTCGCATCGACCGTTATACCTCACCCCGAAAACGAGACTTTAACAAGCTGG
TGGATCGGGATCAATGACACTGGTGATTCTCATCACAATACCTCCATCACTGATTTTACAGCATTTTGGGAAATA
GAGATGCAATCCTACTTTAAAGCTGTTGACCTAGCATCCAGGCATGGTCTCAAAGCCCATCTTTTCCTCAACGTC
CCACCGGGAGAAAGGTCTCCAGGATCTTCAGGAAACCCTGGACTATTAAAAGATCACATACAACTCTTCAACAGC
ATTCTTGTCAATCATATCGATCAATTCACCAAAACGCATCCAGATAACGTTGTTATCACTTTCGACACTCATACC
TGGTTCAATCAAATCCTTGACCATCCAGAGAAATATGGATTCCAGAATGTCACAGGGTTCTGTACATGTGTTGAC
CCGAGTGGCTATTTCTGGTATGATAGCGGCCATCCAACACAACATGTCCACCAGCTTCTGGCCGAGGCCATACAA
CATGGATTAGGCGGCTGA
Transcript >Agabi119p4|682800
ATGTATATATACAAGCTCGAATTCCTCACAGGATGCTTCCAAGGCAGTCCCTTCAATTGCCCTAAACAACTTTGG
AATTTCGCATTTGCAGGCGCAGACATCGACGGGGATATACTTCCCCTACACCATGACTTCACCATTCCATTAGTC
GACCAAGTTACTCAATGGCTAAAATTCGCATCGACCGTTATACCTCACCCCGAAAACGAGACTTTAACAAGCTGG
TGGATCGGGATCAATGACACTGGTGATTCTCATCACAATACCTCCATCACTGATTTTACAGCATTTTGGGAAATA
GAGATGCAATCCTACTTTAAAGCTGTTGACCTAGCATCCAGGCATGGTCTCAAAGCCCATCTTTTCCTCAACGTC
CCACCGGGAGAAAGGTCTCCAGGATCTTCAGGAAACCCTGGACTATTAAAAGATCACATACAACTCTTCAACAGC
ATTCTTGTCAATCATATCGATCAATTCACCAAAACGCATCCAGATAACGTTGTTATCACTTTCGACACTCATACC
TGGTTCAATCAAATCCTTGACCATCCAGAGAAATATGGATTCCAGAATGTCACAGGGTTCTGTACATGTGTTGAC
CCGAGTGGCTATTTCTGGTATGATAGCGGCCATCCAACACAACATGTCCACCAGCTTCTGGCCGAGGCCATACAA
CATGGATTAGGCGGCTGA
Gene >Agabi119p4|682800
ATGTATATATACAAGCTCGAATTCCTCACAGGATGCTTCCAAGGCAGTCCCTTCAATTGCCCTAAACAACTTTGG
AATTTCGCATTTGCAGGCGCAGACATCGACGGGGATATGTAAGTTTTGACATGACACCCACACACATCTCCTAAC
ATTCTGGCCTTAGACTTCCCCTACACCATGACTTCACCATTCCATTAGTCGACCAAGTTACTCAATGGCTAAAAT
TCGCATCGACCGTTATACCTCACCCCGAAAACGAGACTTTAACAAGCTGGTGGATCGGGATCAATGACACTGGTG
ATTCTCATCACAATACCTCCGTTCGTCAAGTCGCCTTTTTTTTCATAGACAAGGCTGTTGAACCAAATGTTACTT
ACACGCAGATCACTGATTTTACAGCATTTTGGGAAATAGAGATGCAATCCTACTTTAAAGCTGTTGCAAGTCAAG
TTCCCCCTTACCACACGCCTAACATATGGGCCTCTAACCATTTTCATAGGACCTAGCATCCAGGCATGGTCTCAA
AGCCCATCTTTTCCTCAACGTCCCACCGGGAGAAAGGTCTCCAGGATCTTCAGGAAACCCTGGACTATTAAAAGA
TCACATACAACTCTTCAACAGCATTCTTGTCAATCATATCGATCAATTCACCAAAACGCATCCAGGTACAGTGCT
CCTCATTCATTCACATCTGCAGCTGAAGATCACTCGGTGATACTGATGTTTATTATAGATAACGTTGTTATCACT
TTCGACACTCATACCTGGTTCAATCAAATCCTTGACCATCCAGAGAAATATGGATTCCAGAATGTCACAGGGTAT
GTTAAATACAGAAATAAACGGATGCCATACCTTTTTCGACTCTTAACGTTTTCCTCACCGCGGAATTTGCAGGTT
CTGTACATGTGTTGACCCGAGTGGCTATTTCTGGTATGGTAAGTTCCTGCCTGACACATCATTGCACATGTCCAG
CTCTTGAACCTCGTGTAGATAGCGGCCATCCAACACAACATGTCCACCAGCTTCTGGCCGAGGCCATACAACATG
GATTAGGCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail