Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|682600
Gene name
Locationscaffold_07:1484273..1486985
Strand+
Gene length (bp)2712
Transcript length (bp)1938
Coding sequence length (bp)1938
Protein length (aa) 646

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08356 EF_assoc_2 EF hand associated 5.2E-35 222 307
PF08355 EF_assoc_1 EF hand associated 2.1E-30 343 411
PF00071 Ras Ras family 4.4E-21 6 168
PF00071 Ras Ras family 1.2E-05 422 535
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 4.5E-10 6 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO78|GEM1_CRYNJ Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GEM1 PE=3 SV=1 2 645 0.0E+00
sp|P0CO79|GEM1_CRYNB Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GEM1 PE=3 SV=1 2 645 0.0E+00
sp|Q4PB75|GEM1_USTMA Mitochondrial Rho GTPase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GEM1 PE=3 SV=1 1 644 0.0E+00
sp|Q4I2W2|GEM1_GIBZE Mitochondrial Rho GTPase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GEM1 PE=3 SV=1 5 619 0.0E+00
sp|Q7RZA2|GEM1_NEUCR Mitochondrial Rho GTPase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gem-1 PE=3 SV=1 1 601 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO78|GEM1_CRYNJ Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GEM1 PE=3 SV=1 2 645 0.0E+00
sp|P0CO79|GEM1_CRYNB Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GEM1 PE=3 SV=1 2 645 0.0E+00
sp|Q4PB75|GEM1_USTMA Mitochondrial Rho GTPase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GEM1 PE=3 SV=1 1 644 0.0E+00
sp|Q4I2W2|GEM1_GIBZE Mitochondrial Rho GTPase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GEM1 PE=3 SV=1 5 619 0.0E+00
sp|Q7RZA2|GEM1_NEUCR Mitochondrial Rho GTPase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gem-1 PE=3 SV=1 1 601 0.0E+00
sp|Q4WN24|GEM1_ASPFU Mitochondrial Rho GTPase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gem1 PE=3 SV=1 5 584 8.0E-177
sp|Q2UM43|GEM1_ASPOR Mitochondrial Rho GTPase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gem1 PE=3 SV=1 5 584 7.0E-171
sp|Q5B5L3|GEM1_EMENI Mitochondrial Rho GTPase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gem1 PE=3 SV=1 5 584 2.0E-168
sp|Q5ZM83|MIRO2_CHICK Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHOT2 PE=2 SV=1 1 559 5.0E-165
sp|Q6C2J1|GEM1_YARLI Mitochondrial Rho GTPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GEM1 PE=3 SV=1 5 585 5.0E-159
sp|Q8BG51|MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus GN=Rhot1 PE=1 SV=1 1 580 7.0E-159
sp|Q6NVC5|MIRO1_DANRE Mitochondrial Rho GTPase 1-A OS=Danio rerio GN=rhot1a PE=2 SV=1 1 580 2.0E-158
sp|Q2HJF8|MIRO1_BOVIN Mitochondrial Rho GTPase 1 OS=Bos taurus GN=RHOT1 PE=2 SV=1 1 580 5.0E-158
sp|Q8JZN7|MIRO2_MOUSE Mitochondrial Rho GTPase 2 OS=Mus musculus GN=Rhot2 PE=1 SV=1 1 580 2.0E-157
sp|Q8IXI2|MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens GN=RHOT1 PE=1 SV=2 1 580 2.0E-157
sp|Q5ZM73|MIRO1_CHICK Mitochondrial Rho GTPase 1 OS=Gallus gallus GN=RHOT1 PE=2 SV=1 1 580 7.0E-155
sp|Q8IXI1|MIRO2_HUMAN Mitochondrial Rho GTPase 2 OS=Homo sapiens GN=RHOT2 PE=1 SV=2 1 559 8.0E-155
sp|Q5E9M9|MIRO2_BOVIN Mitochondrial Rho GTPase 2 OS=Bos taurus GN=RHOT2 PE=2 SV=1 1 559 9.0E-155
sp|Q6DIS1|MIRO2_XENTR Mitochondrial Rho GTPase 2 OS=Xenopus tropicalis GN=rhot2 PE=2 SV=1 1 615 3.0E-154
sp|Q32LU1|MIRO2_DANRE Mitochondrial Rho GTPase 2 OS=Danio rerio GN=rhot2 PE=2 SV=1 1 619 6.0E-153
sp|Q7TSA0|MIRO2_RAT Mitochondrial Rho GTPase 2 OS=Rattus norvegicus GN=Rhot2 PE=2 SV=1 1 582 7.0E-153
sp|O59781|GEM1_SCHPO Mitochondrial Rho GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gem1 PE=3 SV=1 3 559 4.0E-152
sp|Q8IMX7|MIRO_DROME Mitochondrial Rho GTPase OS=Drosophila melanogaster GN=Miro PE=1 SV=1 2 580 2.0E-150
sp|Q6CY37|GEM1_KLULA Mitochondrial Rho GTPase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GEM1 PE=3 SV=1 5 606 3.0E-150
sp|Q298L5|MIRO_DROPS Mitochondrial Rho GTPase OS=Drosophila pseudoobscura pseudoobscura GN=Miro PE=3 SV=1 2 564 6.0E-150
sp|P39722|GEM1_YEAST Mitochondrial Rho GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEM1 PE=1 SV=1 2 617 8.0E-150
sp|Q758X6|GEM1_ASHGO Mitochondrial Rho GTPase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GEM1 PE=3 SV=1 2 584 9.0E-149
sp|F4J0W4|MIRO2_ARATH Mitochondrial Rho GTPase 2 OS=Arabidopsis thaliana GN=MIRO2 PE=2 SV=1 2 584 3.0E-145
sp|Q8RXF8|MIRO1_ARATH Mitochondrial Rho GTPase 1 OS=Arabidopsis thaliana GN=MIRO1 PE=1 SV=1 3 584 2.0E-143
sp|Q6FIR8|GEM1_CANGA Mitochondrial Rho GTPase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GEM1 PE=3 SV=1 2 585 9.0E-141
sp|Q5ABR2|GEM1_CANAL Mitochondrial Rho GTPase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GEM1 PE=3 SV=2 50 585 4.0E-139
sp|Q94263|MIRO1_CAEEL Mitochondrial Rho GTPase 1 OS=Caenorhabditis elegans GN=miro-1 PE=3 SV=1 4 580 2.0E-138
sp|Q864R5|MIRO2_PIG Mitochondrial Rho GTPase 2 OS=Sus scrofa GN=RHOT2 PE=2 SV=1 1 559 4.0E-135
sp|Q623S8|MIRO1_CAEBR Mitochondrial Rho GTPase 1 OS=Caenorhabditis briggsae GN=miro-1 PE=3 SV=3 4 580 5.0E-134
sp|Q9MA88|MIRO3_ARATH Mitochondrial Rho GTPase 3 OS=Arabidopsis thaliana GN=MIRO3 PE=2 SV=1 3 584 1.0E-121
sp|Q55G45|GEMA_DICDI Probable mitochondrial Rho GTPase gemA OS=Dictyostelium discoideum GN=gemA PE=3 SV=1 1 529 9.0E-108
sp|P01122|RHO_APLCA Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 6 170 1.0E-14
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 2 169 2.0E-14
sp|Q6NUX8|RHOAA_DANRE Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 6 170 2.0E-14
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 2 181 4.0E-14
sp|Q3SZA1|RHOF_BOVIN Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 2 183 4.0E-14
sp|Q7T2E8|RHOAC_DANRE Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 6 170 5.0E-14
sp|P24406|RHOA_CANLF Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 6 170 6.0E-14
sp|P61589|RHOA_RAT Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 6 170 6.0E-14
sp|Q9QUI0|RHOA_MOUSE Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 6 170 6.0E-14
sp|Q5REY6|RHOA_PONAB Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 6 170 7.0E-14
sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 6 170 7.0E-14
sp|P61585|RHOA_BOVIN Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 6 170 7.0E-14
sp|Q6DHM9|RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 6 170 9.0E-14
sp|Q6DHE8|RHOAD_DANRE Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 6 170 1.0E-13
sp|Q9PSX7|RHOC_CHICK Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 6 170 2.0E-13
sp|Q5RCK9|RHOC_PONAB Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 6 170 5.0E-13
sp|Q62159|RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 6 170 5.0E-13
sp|P08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 6 170 5.0E-13
sp|Q1RMJ6|RHOC_BOVIN Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 6 170 5.0E-13
sp|Q22038|RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 6 170 1.0E-12
sp|P48148|RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 6 170 2.0E-12
sp|P62747|RHOB_RAT Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1 6 170 4.0E-12
sp|P62746|RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1 6 170 4.0E-12
sp|P62745|RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1 6 170 4.0E-12
sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1 6 170 4.0E-12
sp|P22122|RHO_DIPOM Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 6 170 1.0E-11
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 5 169 2.0E-11
sp|Q9HE04|RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 1 174 6.0E-11
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 3 174 8.0E-11
sp|O00212|RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 3 169 2.0E-10
sp|Q5JT25|RAB41_HUMAN Ras-related protein Rab-41 OS=Homo sapiens GN=RAB41 PE=1 SV=2 6 174 3.0E-10
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 5 171 3.0E-10
sp|Q9GPR2|RACI_DICDI Rho-related protein racI OS=Dictyostelium discoideum GN=racI PE=3 SV=1 5 161 3.0E-10
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 3 171 3.0E-10
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 5 171 3.0E-10
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 3 171 4.0E-10
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 1 170 6.0E-10
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 3 169 7.0E-10
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 3 168 7.0E-10
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 3 169 1.0E-09
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 5 171 1.0E-09
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 3 169 1.0E-09
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 6 161 1.0E-09
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 5 171 1.0E-09
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 3 169 1.0E-09
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 6 161 2.0E-09
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 5 171 2.0E-09
sp|P17081|RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens GN=RHOQ PE=1 SV=2 5 171 2.0E-09
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 5 171 2.0E-09
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 5 171 2.0E-09
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 5 171 2.0E-09
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 5 171 2.0E-09
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 5 171 2.0E-09
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 5 171 2.0E-09
sp|P15153|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1 5 171 2.0E-09
sp|Q9C3Y4|RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 1 169 2.0E-09
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 5 172 2.0E-09
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 3 169 3.0E-09
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 3 161 3.0E-09
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 3 161 3.0E-09
sp|Q9JJL4|RHOQ_RAT Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus GN=Rhoq PE=2 SV=1 5 171 3.0E-09
sp|Q8R527|RHOQ_MOUSE Rho-related GTP-binding protein RhoQ OS=Mus musculus GN=Rhoq PE=1 SV=2 5 171 3.0E-09
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 3 161 3.0E-09
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 3 161 3.0E-09
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 3 161 3.0E-09
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 3 169 3.0E-09
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 3 161 3.0E-09
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 5 183 4.0E-09
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 3 169 4.0E-09
sp|Q24814|RACA_ENTHI Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1 5 171 4.0E-09
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 6 161 4.0E-09
sp|Q9TU25|RAC2_BOVIN Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1 5 171 4.0E-09
sp|P06780|RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 1 169 4.0E-09
sp|Q54HZ7|RACM_DICDI Rho-related protein racM OS=Dictyostelium discoideum GN=racM PE=3 SV=2 3 161 5.0E-09
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 3 161 5.0E-09
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 3 161 5.0E-09
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 3 161 5.0E-09
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 3 171 5.0E-09
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 3 173 5.0E-09
sp|P34149|RACC_DICDI Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1 5 169 6.0E-09
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 6 176 6.0E-09
sp|Q8J212|RHO1_KLULA GTP-binding protein Rho1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RHO1 PE=3 SV=1 1 169 6.0E-09
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 3 169 7.0E-09
sp|Q05144|RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=1 SV=1 5 171 7.0E-09
sp|P25378|RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2 6 168 8.0E-09
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 6 161 8.0E-09
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 6 168 8.0E-09
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 6 169 8.0E-09
sp|Q9HF54|RHO1_ASHGO GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 6 169 9.0E-09
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 6 161 9.0E-09
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 5 161 1.0E-08
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 3 171 1.0E-08
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 3 170 1.0E-08
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 3 170 1.0E-08
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 5 171 1.0E-08
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 6 168 1.0E-08
sp|Q16YG0|CDC42_AEDAE Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 3 174 1.0E-08
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 3 169 1.0E-08
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 7 178 1.0E-08
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 6 168 1.0E-08
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 6 168 2.0E-08
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 6 161 2.0E-08
sp|P34146|RAC1C_DICDI Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 5 171 2.0E-08
sp|Q17031|CDC42_ANOGA Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 3 174 2.0E-08
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 1 174 2.0E-08
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 3 169 3.0E-08
sp|P40793|CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 3 174 3.0E-08
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 5 169 3.0E-08
sp|Q29HY3|CDC42_DROPS Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 3 174 3.0E-08
sp|Q874R1|RHO4_SCHPO GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 6 164 4.0E-08
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 6 173 4.0E-08
sp|P08647|RAS_SCHPO Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ras1 PE=3 SV=2 3 162 4.0E-08
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 5 171 4.0E-08
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 6 161 4.0E-08
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 3 183 4.0E-08
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 3 183 4.0E-08
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 3 183 4.0E-08
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 6 186 4.0E-08
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 6 161 5.0E-08
sp|C4YDI6|CDC42_CANAW Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 3 171 5.0E-08
sp|P0CY33|CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 3 171 5.0E-08
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 6 161 5.0E-08
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 6 161 5.0E-08
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 6 161 5.0E-08
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 6 161 6.0E-08
sp|P60764|RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1 5 169 6.0E-08
sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1 5 169 6.0E-08
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 3 169 6.0E-08
sp|Q8CFN2|CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 3 179 6.0E-08
sp|Q007T2|CDC42_PIG Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 3 179 6.0E-08
sp|P60766|CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 3 179 6.0E-08
sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 3 179 6.0E-08
sp|P60952|CDC42_CANLF Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 3 179 6.0E-08
sp|Q2KJ93|CDC42_BOVIN Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 3 179 6.0E-08
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 6 161 6.0E-08
sp|Q6Z808|RAC3_ORYSJ Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1 3 171 7.0E-08
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 6 161 7.0E-08
sp|Q90694|CDC42_CHICK Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 3 174 7.0E-08
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 6 161 7.0E-08
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 6 161 7.0E-08
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 6 161 7.0E-08
sp|Q4R4R6|CDC42_MACFA Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 3 179 7.0E-08
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 5 162 8.0E-08
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 6 161 8.0E-08
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 6 161 9.0E-08
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 6 161 9.0E-08
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 6 161 1.0E-07
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 6 161 1.0E-07
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 6 161 1.0E-07
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 6 161 1.0E-07
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 6 182 1.0E-07
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 3 169 1.0E-07
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 5 162 1.0E-07
sp|Q9GPR7|RACH_DICDI Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1 1 171 1.0E-07
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 5 162 1.0E-07
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 1 162 1.0E-07
sp|Q94124|RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=3 SV=1 5 171 1.0E-07
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 5 173 1.0E-07
sp|O13928|RHO3_SCHPO GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 6 169 2.0E-07
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 6 161 2.0E-07
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 6 161 2.0E-07
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 3 171 2.0E-07
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 6 161 2.0E-07
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 2 161 2.0E-07
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 4 162 3.0E-07
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 3 161 3.0E-07
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 6 161 3.0E-07
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 3 161 3.0E-07
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 5 161 3.0E-07
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 6 161 4.0E-07
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 6 161 4.0E-07
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 6 161 5.0E-07
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 2 169 5.0E-07
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 3 162 5.0E-07
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 6 182 6.0E-07
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 6 161 6.0E-07
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 6 182 6.0E-07
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 6 161 6.0E-07
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 6 161 6.0E-07
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 6 161 6.0E-07
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 6 161 6.0E-07
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 6 161 6.0E-07
sp|A6NIZ1|RP1BL_HUMAN Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 3 162 6.0E-07
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 6 161 7.0E-07
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 6 161 7.0E-07
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 6 161 7.0E-07
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 6 161 7.0E-07
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 6 184 7.0E-07
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 6 204 7.0E-07
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 3 162 8.0E-07
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 6 161 8.0E-07
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 6 161 8.0E-07
sp|Q24815|RACB_ENTHI Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1 11 161 8.0E-07
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 6 178 8.0E-07
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 3 162 8.0E-07
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 4 162 8.0E-07
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 3 162 9.0E-07
sp|Q01112|CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 5 174 9.0E-07
sp|P34148|RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 3 171 9.0E-07
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 3 161 9.0E-07
sp|Q5RDM6|RAP1B_PONAB Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 3 162 9.0E-07
sp|A5A6J7|RAP1B_PANTR Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 3 162 9.0E-07
sp|Q99JI6|RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 3 162 9.0E-07
sp|Q4R9D4|RAP1B_MACFA Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 3 162 9.0E-07
sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 3 162 9.0E-07
sp|Q5ZHX1|RAP1B_CHICK Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 3 162 9.0E-07
sp|P61223|RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 3 162 9.0E-07
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 5 171 9.0E-07
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 6 161 9.0E-07
sp|Q00246|RHO4_YEAST GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 5 184 9.0E-07
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 6 182 9.0E-07
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 6 161 1.0E-06
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 2 161 1.0E-06
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 3 162 1.0E-06
sp|Q8R367|RERG_MOUSE Ras-related and estrogen-regulated growth inhibitor OS=Mus musculus GN=Rerg PE=2 SV=1 4 162 1.0E-06
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 6 161 1.0E-06
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 6 169 1.0E-06
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 3 162 2.0E-06
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 3 162 2.0E-06
sp|Q0VCJ7|RERG_BOVIN Ras-related and estrogen-regulated growth inhibitor OS=Bos taurus GN=RERG PE=2 SV=1 4 162 2.0E-06
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 5 170 2.0E-06
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 6 198 2.0E-06
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 6 182 2.0E-06
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 6 161 2.0E-06
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 6 182 2.0E-06
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 5 161 2.0E-06
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 5 162 3.0E-06
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 6 119 3.0E-06
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 5 119 3.0E-06
sp|Q54G48|RABO_DICDI Ras-related protein RabO OS=Dictyostelium discoideum GN=rabO PE=3 SV=1 5 164 3.0E-06
sp|Q9GPS0|RACG_DICDI Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1 3 161 3.0E-06
sp|Q9GPQ9|RACJ_DICDI Rho-related protein racJ OS=Dictyostelium discoideum GN=racJ PE=3 SV=1 5 161 3.0E-06
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 6 119 4.0E-06
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 6 134 4.0E-06
sp|C4YKT4|RAS1_CANAW Ras-like protein 1 OS=Candida albicans (strain WO-1) GN=RAS1 PE=3 SV=1 1 162 4.0E-06
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 6 119 4.0E-06
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 2 169 4.0E-06
sp|P0CY32|RAS1_CANAX Ras-like protein 1 OS=Candida albicans GN=RAS1 PE=3 SV=1 1 162 4.0E-06
sp|Q96A58|RERG_HUMAN Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1 4 162 4.0E-06
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 5 185 4.0E-06
sp|Q9P8J9|RHO3_SCHCO GTP-binding protein Rho3 OS=Schizophyllum commune GN=RHO3 PE=2 SV=1 6 161 5.0E-06
sp|Q9D0P8|IFT27_MOUSE Intraflagellar transport protein 27 homolog OS=Mus musculus GN=Ift27 PE=1 SV=1 6 128 5.0E-06
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 5 169 6.0E-06
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 5 171 6.0E-06
sp|Q59XU5|RAS1_CANAL Ras-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAS1 PE=3 SV=1 1 162 6.0E-06
sp|P08645|RAS3_DROME Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 3 162 6.0E-06
sp|Q23862|RACE_DICDI Rho-related protein racE OS=Dictyostelium discoideum GN=racE PE=1 SV=1 5 180 6.0E-06
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 5 176 7.0E-06
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 1 169 7.0E-06
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 1 169 7.0E-06
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 1 169 7.0E-06
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 3 161 8.0E-06
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 3 161 8.0E-06
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 6 170 8.0E-06
sp|Q0VCN3|IFT27_BOVIN Intraflagellar transport protein 27 homolog OS=Bos taurus GN=IFT27 PE=2 SV=1 6 170 9.0E-06
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 5 181 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0016787 hydrolase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 599 618 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|682600
MRRDVRILLVGDEGVGKSTIITSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGAGPQDRAHLESEIRKA
HVICVVYSIDNPNSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEVTNEALEDEIVPIMNEFKEVETCVECS
AKLPLNVSEVFYFAQKAVLHPTAPLYDSRDHVLKPACVAALRRIFKICDTNKDGILDAAELNEFQRKCFDAPLQL
QELEGIRAMVQEHADGGVRDGGLTEAGFLYLHTIFIQRGRLETTWTVLRKFGYAEDLRLTEAFLMPRFDVPSDCS
VELSPLGYQFFTDIFETFDKDQDGALKIDELDEVFSTSPGNPWATQKFPDTTLSDDTGAVTLQGWLAQWSMTTLL
DHKTTLAYLAYLGYPGESQTEALQVTRARKLDRRKGKVTRNVFLCYVCGAAGSGKTALLRAFAGKPYNPAYEPTS
KPINVVNAVDLDGSEKYLVLQEFGSRYEAETLRSSKKTDQPDVIVYVHDSSDTNSFSYISNLRQQYSLDHIPTLF
VATKSDLDLALQRHEVQPDVYCRRLSLQVPVSVSVKDGQLADVFHTICRIAMNPNSAIPGGADRALTPAARLRMY
FTLTAILGGCTAALVVLFRNVRTPLGLGGWGAPWSSWLLGVGGRR*
Coding >Agabi119p4|682600
ATGAGGCGAGATGTACGCATTCTCCTCGTCGGCGATGAGGGTGTAGGCAAGAGCACCATCATCACGTCCCTAATT
AAGGAATCCTTCGTCGCTCATGTTCAACATGTTGTTCCCGAGGTTACAATTCCTCCAGAGGTCACTCCGGAAAAC
GTCACGACCTACATCGTCGATTCGGGAGCCGGACCGCAGGACCGTGCGCATCTCGAATCCGAAATCAGAAAAGCG
CATGTCATTTGCGTCGTTTATTCTATAGACAACCCTAATTCCTTTGACCGCATCCCCACCTACTGGTTACCGCAC
TTCCGCCAACTTGGTGTCAACGTCCCTGTTATCCTCGTTGGCAATAAAATCGACTTGCGTGGCGGAGAGGTTACC
AACGAGGCACTGGAGGATGAGATTGTTCCTATTATGAACGAGTTTAAGGAAGTAGAAACTTGCGTCGAGTGTTCC
GCCAAACTTCCCCTCAACGTTTCTGAAGTCTTCTATTTTGCTCAGAAGGCTGTTTTACATCCTACAGCACCCCTC
TATGATTCTCGCGATCATGTCCTCAAGCCTGCATGTGTAGCGGCACTACGTCGAATATTTAAAATTTGCGACACA
AATAAAGACGGAATACTTGACGCTGCCGAACTCAATGAGTTCCAGCGTAAATGTTTCGATGCCCCTCTACAGCTA
CAAGAACTCGAAGGGATCAGAGCCATGGTTCAAGAGCATGCTGATGGCGGTGTACGAGATGGGGGCCTAACTGAA
GCTGGTTTCTTATATTTGCACACTATCTTTATTCAACGTGGACGCCTCGAAACGACATGGACTGTGTTACGCAAA
TTCGGATATGCAGAGGACCTTCGACTGACGGAAGCCTTCCTTATGCCTAGATTTGATGTTCCTTCGGACTGCTCT
GTTGAACTGAGTCCATTGGGATACCAATTCTTCACGGATATTTTTGAGACATTTGATAAAGATCAGGATGGCGCC
CTCAAGATCGACGAGTTGGATGAAGTTTTCAGTACATCGCCCGGTAATCCTTGGGCAACGCAAAAGTTTCCTGAC
ACGACGTTGTCTGATGACACGGGCGCTGTGACATTACAGGGGTGGTTAGCCCAATGGAGTATGACAACACTCTTG
GACCACAAAACCACGCTCGCATATCTAGCGTATTTGGGCTACCCTGGCGAATCACAGACCGAAGCATTACAAGTG
ACGAGAGCGCGGAAACTGGACAGAAGAAAGGGCAAAGTTACGCGAAATGTCTTTTTGTGTTATGTTTGTGGTGCA
GCTGGATCAGGGAAGACGGCTCTCCTTCGGGCTTTTGCAGGGAAGCCTTATAACCCCGCGTACGAGCCCACGAGC
AAACCTATAAACGTGGTGAACGCGGTGGATCTCGATGGGTCAGAAAAGTACTTGGTGCTGCAAGAGTTTGGATCA
CGTTACGAGGCAGAAACTCTGCGAAGTTCAAAGAAAACCGATCAACCAGATGTGATAGTTTACGTGCACGACTCG
AGCGACACAAATTCGTTTTCATATATCAGCAACCTACGGCAACAATATAGTTTGGACCATATACCCACACTTTTC
GTGGCAACGAAGTCTGATTTGGACCTAGCGTTACAGCGGCATGAAGTGCAACCAGATGTGTATTGCAGACGATTA
AGCCTGCAAGTGCCCGTGTCCGTCAGTGTCAAGGATGGACAATTGGCAGACGTGTTTCATACTATTTGCAGAATA
GCGATGAACCCTAATTCGGCGATACCTGGCGGCGCCGACCGTGCGTTGACACCAGCCGCGAGGCTAAGGATGTAT
TTTACGCTGACTGCGATCTTGGGAGGGTGCACGGCTGCGCTGGTGGTGTTATTTCGGAATGTACGGACACCGCTA
GGGCTAGGGGGCTGGGGAGCGCCTTGGAGCAGCTGGCTGTTGGGGGTAGGCGGTAGACGGTAG
Transcript >Agabi119p4|682600
ATGAGGCGAGATGTACGCATTCTCCTCGTCGGCGATGAGGGTGTAGGCAAGAGCACCATCATCACGTCCCTAATT
AAGGAATCCTTCGTCGCTCATGTTCAACATGTTGTTCCCGAGGTTACAATTCCTCCAGAGGTCACTCCGGAAAAC
GTCACGACCTACATCGTCGATTCGGGAGCCGGACCGCAGGACCGTGCGCATCTCGAATCCGAAATCAGAAAAGCG
CATGTCATTTGCGTCGTTTATTCTATAGACAACCCTAATTCCTTTGACCGCATCCCCACCTACTGGTTACCGCAC
TTCCGCCAACTTGGTGTCAACGTCCCTGTTATCCTCGTTGGCAATAAAATCGACTTGCGTGGCGGAGAGGTTACC
AACGAGGCACTGGAGGATGAGATTGTTCCTATTATGAACGAGTTTAAGGAAGTAGAAACTTGCGTCGAGTGTTCC
GCCAAACTTCCCCTCAACGTTTCTGAAGTCTTCTATTTTGCTCAGAAGGCTGTTTTACATCCTACAGCACCCCTC
TATGATTCTCGCGATCATGTCCTCAAGCCTGCATGTGTAGCGGCACTACGTCGAATATTTAAAATTTGCGACACA
AATAAAGACGGAATACTTGACGCTGCCGAACTCAATGAGTTCCAGCGTAAATGTTTCGATGCCCCTCTACAGCTA
CAAGAACTCGAAGGGATCAGAGCCATGGTTCAAGAGCATGCTGATGGCGGTGTACGAGATGGGGGCCTAACTGAA
GCTGGTTTCTTATATTTGCACACTATCTTTATTCAACGTGGACGCCTCGAAACGACATGGACTGTGTTACGCAAA
TTCGGATATGCAGAGGACCTTCGACTGACGGAAGCCTTCCTTATGCCTAGATTTGATGTTCCTTCGGACTGCTCT
GTTGAACTGAGTCCATTGGGATACCAATTCTTCACGGATATTTTTGAGACATTTGATAAAGATCAGGATGGCGCC
CTCAAGATCGACGAGTTGGATGAAGTTTTCAGTACATCGCCCGGTAATCCTTGGGCAACGCAAAAGTTTCCTGAC
ACGACGTTGTCTGATGACACGGGCGCTGTGACATTACAGGGGTGGTTAGCCCAATGGAGTATGACAACACTCTTG
GACCACAAAACCACGCTCGCATATCTAGCGTATTTGGGCTACCCTGGCGAATCACAGACCGAAGCATTACAAGTG
ACGAGAGCGCGGAAACTGGACAGAAGAAAGGGCAAAGTTACGCGAAATGTCTTTTTGTGTTATGTTTGTGGTGCA
GCTGGATCAGGGAAGACGGCTCTCCTTCGGGCTTTTGCAGGGAAGCCTTATAACCCCGCGTACGAGCCCACGAGC
AAACCTATAAACGTGGTGAACGCGGTGGATCTCGATGGGTCAGAAAAGTACTTGGTGCTGCAAGAGTTTGGATCA
CGTTACGAGGCAGAAACTCTGCGAAGTTCAAAGAAAACCGATCAACCAGATGTGATAGTTTACGTGCACGACTCG
AGCGACACAAATTCGTTTTCATATATCAGCAACCTACGGCAACAATATAGTTTGGACCATATACCCACACTTTTC
GTGGCAACGAAGTCTGATTTGGACCTAGCGTTACAGCGGCATGAAGTGCAACCAGATGTGTATTGCAGACGATTA
AGCCTGCAAGTGCCCGTGTCCGTCAGTGTCAAGGATGGACAATTGGCAGACGTGTTTCATACTATTTGCAGAATA
GCGATGAACCCTAATTCGGCGATACCTGGCGGCGCCGACCGTGCGTTGACACCAGCCGCGAGGCTAAGGATGTAT
TTTACGCTGACTGCGATCTTGGGAGGGTGCACGGCTGCGCTGGTGGTGTTATTTCGGAATGTACGGACACCGCTA
GGGCTAGGGGGCTGGGGAGCGCCTTGGAGCAGCTGGCTGTTGGGGGTAGGCGGTAGACGGTAG
Gene >Agabi119p4|682600
ATGAGGCGAGATGTACGCATTCTCCTCGTCGGCGATGGTCAGTTCTGTTTCCTCTGTCTCTTCGCCAAGTCCGAC
TCACGCACGCGAGCAGAGGGTGTAGGCAAGAGCACCATCATCACGTCCCTAATTAAGGAATCCTTCGTCGCTCAT
GTACGCGTTCTAATCCTCTACTACTCTCGGATTCCTACATCACTCTCAGGTTCAACATGTTGTTCCCGAGGTTAC
AATTCCTCCAGAGGTCACTCCGGAAAACGTCACGACCTACATCGTCGATTCGGGAGGTGAGTCTCCTTTCGTCTC
CTGACTAGCACAACTTGCTGACCTTTGTATCCTATCTCGCCAGCCGGACCGCAGGACCGTGCGCATCTCGAATCC
GAAATCAGAAAAGCGCATGTCATTTGCGTCGTTTATTCTATAGACAACCCTAATTCCTTTGACCGCATCCCCACC
TACTGGTTACCGCACTTCCGCCAACTTGGTGTCAACGTAATATCCTTCTTCGTATTCAGTGCTCATGCTCAAGAC
GGCCAATAGGTCCCTGTTATCCTCGTTGGCAATAAAATCGACTTGCGTGGCGGAGAGGTTACCAACGAGGCACTG
GAGGATGAGATTGTTCCTATTATGAACGAGTTTAAGGTTCGTTTGACCCGCTGCGTTTACGCGTGATAACCAAAT
TTGATCCTTAATTTTGGCGTGAAGGAAGTAGAAACTTGCGTCGAGTGTTCCGCCAAACTTCCCCTCAACGTTTCT
GAAGTCTTCTATTTTGCTCAGAAGGCTGTTTTACATCCTACAGCACCCCTCTATGATTCTCGCGATCATGTCCGT
ACTCCTTTCATTCGCTTGCCGGATCTAACATCTCACTACCTTAATCAGGTCCTCAAGCCTGCATGTGTAGCGGCA
CTACGTCGAATATTTAAAATTTGCGACACAAATAAAGACGGAATACTTGACGCTGCCGAACTCAATGAGTTCCAG
GTATGTTTGGTAGCCTCTTTTCAGATCTCGCTTTTTGATGAAATCTGCGTCGAAAATTAGCGTAAATGTTTCGAT
GCCCCTCTACAGCTACAAGAACTCGAAGGGATCAGAGCCATGGTTCAAGAGCATGCTGATGGCGGTGTACGAGAT
GGGGGCCTAACTGAAGCTGGTTTCTTATATTTGCACACTATCTTTATTCAACGTGGACGCCTCGAAACGACATGG
ACTGTGTTACGCAAATTCGGATATGCAGAGGACCTTCGACTGACGGAAGCCTTCCTTATGCCTAGGTACGTGTAC
TATAATACCTGTAACGAATTCCAAAGGAACCCTGTAAATTTTTATTTACCTAGATTTGATGTTCCTTCGGACTGC
TCTGTTGAACTGAGTCCATTGGGATACCAATTCTTCACGGATATTTTTGAGACATTTGATAAAGTAAGTTGGTTT
GCCCTAACTAGGCAATTCATTGTTCCTAATTCCTGTGCCTAGGATCAGGATGGCGCCCTCAAGATCGACGAGTTG
GATGAAGTTTTCAGTACATCGCCCGGTAATCCTTGGGCAACGCAAAAGTTTCCTGACACGACGTTGTCTGATGAC
ACGGGCGCTGTGACATTACAGGGGTGGTTAGCCCAATGGAGGTGTGTCTTCCCAAAGTTTGATCTAGAATTTCTT
ATTCATAGCACATGAGGCAGTATGACAACACTCTTGGACCACAAAACCACGCTCGCATATCTAGCGTATTTGGGC
TACCCTGGCGAATCACAGACCGAAGCATTACAAGTGACGAGAGCGCGGAAACTGGACAGAAGAAAGGGCAAAGTT
ACGCGAAATGTCTTTTTGTGTTATGTTTGTGGTGCAGCTGGATCAGGGAAGACGGCTCTCCTTCGGGCTTTTGCA
GGGAAGCCTTATAACCCCGCGTACGAGCCCACGAGCAAACCTATAAACGTGGTGAACGCGGTGGATCTCGATGGG
TCAGAAAAGTACTTGGTGGTTAGTGTTCCTATTGGGTTGGGTGTACATTGCGATTGACCATTTTCTCCTAGCTGC
AAGAGTTTGGATCACGTTACGAGGCAGAAACTCTGCGAAGTTCAAAGAAAACCGATCAACCAGATGTGATAGTTT
ACGTGCACGACTCGAGCGACACAAATTCGTTTTCATATATCAGCAACCTACGGGTGAGTGGACAAGTGTAGCAAC
TTATCGGGAGATGCTCATTGAGTGAATGTAGCAACAATATAGTTTGGACCATATACCCACACTTTTCGTGGCAAC
GAAGTCTGATTTGGACCTAGCGTTACAGGTGAGGATATTTTAACCGGAAATGGGAAGGGTCTATTGATCTACGCG
TGTCCAGCGGCATGAAGTGCAACCAGATGTGTATTGCAGACGATTAAGCCTGCAAGTGCCCGTGTCCGTCAGTGT
CAAGGATGGACAATTGGCAGACGTGTTTCATACTATTTGCAGAATAGCGATGAACCCGTAAGTAGCCCACGTTTT
TCTGCAGGCGTTTCTGATGAGGTGTGTGTATTTAGTAATTCGGCGATACCTGGCGGCGCCGACCGTGCGTTGACA
CCAGCCGCGAGGCTAAGGATGTATTTTACGCTGACTGCGATCTTGGGAGGGTGCACGGCTGCGCTGGTGGTGTTA
TTTCGGAATGTACGGACACCGCTAGGGCTAGGGGGCTGGGGAGCGCCTTGGAGCAGCTGGCTGTTGGGGGTAGGC
GGTAGACGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail