Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|681500
Gene name
Locationscaffold_07:1055650..1064332
Strand-
Gene length (bp)8682
Transcript length (bp)8208
Coding sequence length (bp)8208
Protein length (aa) 2736

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07728 AAA_5 AAA domain (dynein-related subfamily) 4.9E-09 409 534
PF07728 AAA_5 AAA domain (dynein-related subfamily) 3.2E-07 761 807
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.7E-08 929 1013
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.8E-20 1199 1336
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.6E-07 1494 1553
PF07728 AAA_5 AAA domain (dynein-related subfamily) 3.1E-15 1604 1696
PF07728 AAA_5 AAA domain (dynein-related subfamily) 4.1E-15 1876 2015
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.2E-08 2320 2403
PF17867 AAA_lid_7 Midasin AAA lid domain 2.0E-18 564 687
PF17867 AAA_lid_7 Midasin AAA lid domain 5.2E-12 1348 1440
PF17867 AAA_lid_7 Midasin AAA lid domain 2.6E-16 2027 2123
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 2.2E-09 1877 2016
PF17865 AAA_lid_5 Midasin AAA lid domain 1.6E-24 1028 1130
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.6E-04 1877 1911

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 375 2413 0.0E+00
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 313 2413 0.0E+00
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 748 2417 0.0E+00
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 130 2413 0.0E+00
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 346 2232 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 375 2413 0.0E+00
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 313 2413 0.0E+00
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 748 2417 0.0E+00
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 130 2413 0.0E+00
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 346 2232 0.0E+00
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 1199 2438 3.0E-94
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 1177 2425 5.0E-85
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 1607 2435 5.0E-70
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 1173 2414 2.0E-66
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 913 1708 3.0E-65
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 1877 2430 2.0E-36
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 2309 2413 3.0E-32
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 379 1129 9.0E-26
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 342 811 1.0E-16
sp|Q51481|NIRQ_PSEAE Denitrification regulatory protein NirQ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nirQ PE=2 SV=1 1198 1379 1.0E-16
sp|Q02441|NIRQ_PSEST Denitrification regulatory protein NirQ OS=Pseudomonas stutzeri GN=nirQ PE=2 SV=1 1198 1379 3.0E-16
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 1198 1356 3.0E-15
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1872 2121 1.0E-14
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1200 1396 2.0E-14
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1872 2121 2.0E-14
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1200 1396 3.0E-14
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 1200 1396 4.0E-14
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 1200 1396 4.0E-14
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 1200 1396 4.0E-14
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 1200 1396 4.0E-14
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 1200 1396 4.0E-14
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 1200 1396 4.0E-14
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 1200 1396 4.0E-14
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1200 1396 4.0E-14
sp|Q2YY09|Y1265_STAAB Uncharacterized protein SAB1265c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1265c PE=3 SV=1 1200 1396 4.0E-14
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1200 1396 8.0E-14
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1200 1396 8.0E-14
sp|Q51858|CBBQ_HYDTE Protein CbbQ OS=Hydrogenophilus thermoluteolus GN=cbbQ PE=3 SV=1 1197 1370 2.0E-13
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 1873 2054 3.0E-13
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 1873 2054 3.0E-13
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 1873 2054 3.0E-13
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 1873 2054 3.0E-13
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 1873 2054 3.0E-13
sp|Q2YY09|Y1265_STAAB Uncharacterized protein SAB1265c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1265c PE=3 SV=1 1873 2054 3.0E-13
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 1873 2054 3.0E-13
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 1873 2054 3.0E-13
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 2323 2430 5.0E-13
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1872 2054 7.0E-13
sp|P29933|COBS_PSEDE Aerobic cobaltochelatase subunit CobS OS=Pseudomonas denitrificans GN=cobS PE=1 SV=1 1160 1336 2.0E-12
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1873 2054 2.0E-12
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1873 2054 3.0E-12
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 1200 1345 7.0E-10
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 914 1101 2.0E-09
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 2321 2413 4.0E-09
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 1929 2125 8.0E-09
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 1870 2054 9.0E-09
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 929 1101 1.0E-08
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 1903 2164 2.0E-08
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 1229 1341 2.0E-08
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 1607 1701 2.0E-08
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 922 1101 4.0E-08
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1566 1705 5.0E-08
sp|Q51481|NIRQ_PSEAE Denitrification regulatory protein NirQ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nirQ PE=2 SV=1 1869 2018 8.0E-08
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 459 807 1.0E-07
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 929 1101 3.0E-07
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1566 1705 4.0E-07
sp|Q2YY09|Y1265_STAAB Uncharacterized protein SAB1265c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1265c PE=3 SV=1 1566 1705 4.0E-07
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 1566 1705 5.0E-07
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1566 1705 5.0E-07
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 1566 1705 5.0E-07
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 1566 1705 5.0E-07
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 1566 1705 5.0E-07
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 1566 1705 5.0E-07
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1566 1705 5.0E-07
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 1566 1705 5.0E-07
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 1566 1705 5.0E-07
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 1876 2000 7.0E-07
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 395 575 2.0E-06
sp|Q02441|NIRQ_PSEST Denitrification regulatory protein NirQ OS=Pseudomonas stutzeri GN=nirQ PE=2 SV=1 1869 2027 3.0E-06
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1489 1705 3.0E-06
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 2321 2423 3.0E-06
sp|P29933|COBS_PSEDE Aerobic cobaltochelatase subunit CobS OS=Pseudomonas denitrificans GN=cobS PE=1 SV=1 1861 2001 3.0E-06
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 923 1019 3.0E-06
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 926 1030 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0016787 hydrolase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|681500
MTSAGVPGTDASIATQIPTTTKIEWPELEPESSAFSDESMAATAVLFTSPNTTATFDASLLRDPLKINLKQQIKK
LIVAIQHSTIESRLPTVLENFNSFACGLRAVVERKVLLDAVSRCLSVPQLLETVVDLFRPLLIDLVARWLDDEKV
DGEVKEERLIALTYIVEVYEEIFPIFHEFLTKFYPDGPLAASATQSSTPFGEVERLHRLLLTYFRIQQANRELPL
QLFWSLTPLSKLIWSSNHNQDDNGVKLLAIRCYAYQSGMGEAEREKMERKVLNMKDDEMCSVDCWISAGGFGKKD
EEGKERLLDGWVLPMLEVQRVKDMREGLYDVDLETFYGFEDEEERVCVEELDLSPRVANIHGVLLLRQSTAPARP
SVLIATPTSIRSLQALALHISMRAPTLLTSSPSAGKSLLLDHLARSLYPDTENQIITIHLADTSLDPRSLLGSYI
SSSTQPGSFEWKEGVLVRAMREGRWVVFEDIDRGSNEVLGVIKPLVESLRLGNWIGARAKVDVPSRGTIVAHQNF
LVFATRSLQPSRNGKFVQPTFFGAHKFCETIIRAPEGDELKMIIERRCVRLGSNAVEGLIDLWTEVKALGMVASV
RDVGLRELEKLCARVERLLPMSDQSMDIDPSEGGIVPLWNIFTNPSLREEIYLEARDVFFGASATTTSAKNHFDS
VAAIVGKKLGLDEERQEWLLKGRVFVLDIEKDVNGNISGVSIGRTRLAAKQRKSLVDLPPSRPFAMHRPAVCLLS
RIMTSVALSEPVLLTGETGTGKTSVVTHLASLLGRSLISLNLSHQTESSDLIGGLKPIDTRVPASVLQERFLELF
GSTFSRKKNEKFESEVRKAVNEGRWKRVVGLWKESGRLARERLTARKAERMSEADHGRGEPEAPRKRRKFNAVES
IAVWDTFLKDVDEFDIQHVQGKGKFAFGFVEGPLVKALRSGDWILLDEINLASPETLECISGLLHGPTASITLTE
QGSLEPVPRHPDFRLFACMNPATDVGKKDLPPNIRSRFTEIDVPPPDADKDTLLTIITQYIGACAVGDKGIIMNV
AEFYIAAKGLAGKRQLADGANHRPHFSMRTLARALTFASDMANMYSLRRAVWEGCLMAFTMVLDPSSAEILVGLM
HKHLLVGVRNPRSMLSMEPAVPRGHSAEQFVKFGPFYLKRGPYPEDPMEGYILTPSVETKLIDLARIVTTRRFPV
LIEGPTSSGKTSSVEYLARRTGHRFVRINNHEHTDIQEYLGSYVSDPLTGKLVFKDGLLVHALRNGDWIVLDELN
LAPTDVLEALNRLLDDNRELLIPETQEVIRPHPQFMLFATQNPPGLYAGRKILSRAFRNRFLEVHFQDVPQAELE
SILCQRCKIAPSYGKRIVAVFQELQKRRQAGRVFESKQGFATLRDLFRWANRDALGYQELADNGYMLLAERARRD
DDKAVVKEVIQSIMGAQINEDVLYNLHQPSVNMPEFLGTPLPLTSDVVWTKAMQRLYILLCRALKFNEPVLLVGE
TGSGKTSVCQIFAEATGQRLHGLNCHQNTETADIIGALRPVRNRTALEAEVFQEASSALAASGVQPTDSSFEGLA
SALEKALKLSCSTYHGLLSHARSRLLGLQSIFEWHDGPLVEAMGRGDIFLLDEISLADDSVLERLNSVLEPARTI
VLAEKGGSDFVHPVVKAMDAFKLVATMNPGGDYGKKELSPALRNRFTEIWVPRVDRRADLELIVGSLWKHANLRP
YTQKVLDYTEWLSSRVGDRSIASLRDIIAWVMFSNAVYTVEGAISSSGVFHHAAQMTYLDGLASLPQLSAYSRDA
LTRLKEEATRKLNEMVPLTDTNFHEPVFDPTQFVQFGSFGIKKGSLETEPLVFNLAAPTSRSNAMRILRACQLSK
PVLLEGSPGVGKTSLITALANISGHHLCRINLSDQTDLIDLFGSDLPVEGGSPGEFAWRDAEFLKALQHGHWVLL
DEMNLAPQTVLEGLNAVLDHRGTVYIPELGKTFTCHPSFRIFAAQNPINQGGGRKGLPKSFVNRFTKVYIEELTS
ADLTLVCQHMFPDMDENVLHAMIAFNNSLNDEVTHRKTFGRAGAPWEFNLRDVIRWGRLLSSYRNRAPVTFLRSV
YLQRFRTNEDRRRVQGIFDAIFTSSTPSFEQAPPSFFSPSELQVGHFSTTRHNFSTLSRPERLLKVQTAPMETLG
DCVSQNWLAIVTGPRDSGKSHLIRALANFTGNPLREISMNSATDTMDIIGSFEQVDVRALAIDLIHDILQLAEED
FRNPKQAQELHDLIATRDSLNLAVSGPLTQEMIVSLLGQASDFLSDLTNHCGASGEVQQRIKTLLQSPWVGRFEW
MDGPLVQAMRQGKWLLLDGANLCNPSVLDRLNSLCEPNGQLTLNERGLVQDVIEVIKPHPNFRLFMTVDPQHGEL
SRAMRNRGIEIFIPLGILPDDYLIVSDHLRLPRLQTPVEHANLLSLNHLSSRRGLAKSLYQREKITTSSGRSLDH
FTPLSNVMDRFPLYLNASNDMYLDASTFFLSRTFHPAYFPYFRRVLDTCDGTNGQLKQYLHAFVNLLSSPPSLSV
TSRIKDMLTQVRKCSSEILSAQAMDDFANELSTSFTESDADAVLNILDFIAAVFLQRENTGPDGYEPRFSTPMVE
RIHQAIKNFLDQLSRLNEHILNTLSSDADIVEVLNALPLVLAVNKCGRFLHTISSQALLNHSAVQVVVRMIRDVL
NGAPPLLLSLSTDATYGYGGVVKMHCQPAIRGGYD*
Coding >Agabi119p4|681500
ATGACTTCAGCTGGTGTTCCTGGCACCGACGCTTCTATCGCAACTCAAATCCCAACTACTACAAAAATCGAGTGG
CCAGAACTCGAACCCGAATCATCTGCATTCTCAGATGAATCCATGGCAGCAACCGCTGTTCTTTTTACATCTCCC
AATACAACAGCTACATTTGATGCAAGTCTTCTTCGTGACCCACTCAAAATCAACTTGAAGCAACAAATTAAAAAG
TTGATTGTTGCCATTCAACATTCGACAATCGAATCCCGTTTACCTACTGTTCTGGAAAATTTCAACTCGTTTGCT
TGTGGTCTTCGTGCTGTGGTCGAGAGAAAAGTCTTGTTGGATGCAGTGTCGAGGTGTCTGAGCGTACCTCAGTTG
CTTGAGACTGTTGTGGATTTGTTCAGGCCGCTGTTAATCGATTTGGTTGCGAGGTGGTTGGACGATGAAAAGGTC
GATGGAGAGGTGAAGGAGGAGAGGTTGATTGCTTTGACTTATATCGTTGAGGTTTATGAGGAAATCTTCCCGATA
TTTCACGAATTTTTGACCAAATTTTACCCTGATGGCCCACTTGCAGCTAGCGCCACACAATCCAGTACACCCTTC
GGAGAGGTTGAACGATTACACCGTCTCCTTTTGACATATTTCCGCATTCAACAAGCCAACCGCGAACTCCCTCTT
CAACTGTTCTGGAGTTTAACGCCGCTCAGCAAACTTATATGGTCATCTAACCATAATCAAGATGATAATGGAGTT
AAATTACTCGCTATCCGATGTTACGCTTATCAAAGTGGAATGGGTGAGGCGGAGAGAGAGAAGATGGAGAGGAAA
GTTCTGAATATGAAAGACGATGAAATGTGCAGCGTTGATTGTTGGATTTCCGCTGGTGGTTTCGGGAAGAAGGAT
GAGGAGGGGAAGGAAAGGCTCTTGGATGGCTGGGTGTTGCCTATGCTAGAGGTACAGAGAGTTAAGGATATGAGG
GAGGGGCTATATGATGTTGATTTAGAGACGTTCTACGGATTTGAGGATGAAGAAGAGAGAGTATGTGTTGAAGAG
CTCGATTTGAGTCCTCGTGTTGCGAACATTCATGGCGTCTTACTCCTTCGACAGTCCACGGCGCCCGCGCGTCCC
TCGGTGCTTATAGCTACGCCTACTTCTATCAGGTCTCTCCAGGCTCTTGCTCTTCATATATCCATGCGTGCTCCT
ACGCTCCTCACATCATCACCGTCCGCTGGAAAAAGTCTTTTGCTAGATCATCTTGCCCGGTCACTTTATCCCGAC
ACCGAGAACCAAATCATTACTATTCATCTCGCTGATACATCACTCGATCCTCGATCTCTACTCGGTTCATACATC
TCTTCTTCAACTCAACCTGGGAGTTTTGAATGGAAAGAGGGTGTCCTGGTGCGCGCAATGCGTGAAGGTCGTTGG
GTAGTCTTTGAAGATATTGATCGAGGAAGTAATGAAGTTCTTGGAGTCATCAAACCTCTCGTTGAGTCACTGCGG
CTCGGAAATTGGATAGGTGCGCGAGCAAAGGTGGATGTTCCATCCAGAGGAACTATCGTTGCACATCAGAATTTT
CTGGTGTTTGCAACCCGTTCTTTACAACCATCGAGAAATGGGAAATTTGTTCAACCAACTTTTTTTGGTGCCCAC
AAGTTTTGCGAGACGATCATTAGAGCTCCAGAGGGAGACGAGCTGAAGATGATAATAGAGAGACGGTGTGTGAGG
TTGGGAAGCAATGCTGTGGAGGGGTTGATTGATCTTTGGACAGAAGTGAAGGCGTTGGGGATGGTGGCGAGTGTG
AGGGATGTTGGATTAAGGGAGCTGGAAAAGTTGTGTGCTAGAGTGGAGAGGCTGTTACCAATGTCGGATCAGTCA
ATGGACATTGATCCATCAGAAGGAGGCATTGTGCCGCTTTGGAATATCTTCACAAATCCTTCGTTGAGAGAGGAG
ATATATCTGGAGGCACGGGACGTGTTCTTCGGCGCGAGCGCAACGACTACCTCAGCCAAGAATCATTTTGATAGT
GTTGCTGCCATTGTTGGCAAGAAACTTGGTTTGGATGAAGAAAGACAAGAATGGTTGCTGAAAGGAAGGGTATTT
GTTTTGGATATCGAGAAGGATGTGAATGGGAACATCAGTGGTGTATCCATAGGGAGAACAAGATTGGCTGCGAAG
CAGAGGAAGAGTTTAGTTGATCTACCACCTTCAAGACCTTTCGCTATGCATCGCCCCGCTGTGTGTCTACTCTCT
CGTATTATGACGAGCGTGGCACTCTCCGAACCTGTCTTACTCACCGGTGAGACGGGTACAGGAAAAACTAGTGTC
GTCACGCATTTAGCGTCTTTGCTTGGGCGTTCGCTTATCTCTCTCAACTTGTCCCATCAGACAGAATCATCGGAT
TTGATTGGTGGATTGAAGCCTATTGATACGAGGGTTCCCGCGTCTGTGCTTCAAGAAAGATTCTTGGAGTTATTT
GGGTCCACTTTTAGTAGGAAGAAGAATGAGAAGTTCGAGTCGGAGGTTAGGAAAGCTGTGAACGAAGGAAGATGG
AAGAGAGTTGTGGGACTTTGGAAGGAGAGCGGAAGATTGGCTAGGGAGCGTTTGACGGCGAGAAAGGCCGAACGG
ATGAGCGAGGCTGATCATGGACGTGGTGAACCTGAGGCCCCTCGTAAGCGGAGGAAGTTTAATGCTGTAGAATCC
ATTGCTGTATGGGATACTTTTTTGAAGGACGTCGATGAATTCGATATCCAGCACGTGCAAGGAAAAGGCAAATTT
GCTTTTGGATTCGTAGAAGGTCCTTTGGTCAAGGCATTACGGTCAGGCGATTGGATCTTGCTGGACGAAATTAAC
CTTGCAAGCCCAGAAACCCTCGAATGTATCTCCGGATTACTCCATGGTCCAACTGCATCCATTACCCTCACGGAG
CAAGGATCCCTTGAGCCTGTACCTCGCCACCCAGATTTCCGGCTATTTGCCTGCATGAACCCGGCAACTGATGTC
GGCAAGAAAGATCTCCCCCCGAATATCCGTTCCCGGTTTACCGAGATCGACGTTCCGCCACCAGATGCTGATAAA
GATACACTCTTGACCATAATCACCCAATATATCGGAGCATGTGCAGTTGGAGACAAAGGGATCATTATGAACGTG
GCAGAGTTTTATATCGCCGCCAAAGGTCTGGCCGGGAAGCGCCAGCTCGCAGATGGTGCCAACCATAGACCACAT
TTTAGTATGCGGACATTGGCACGTGCGTTGACCTTCGCTTCTGATATGGCAAATATGTATAGTTTGCGTCGGGCT
GTTTGGGAGGGTTGTTTGATGGCTTTTACGATGGTTTTGGATCCATCGAGTGCGGAGATTTTGGTGGGGCTAATG
CACAAACACTTGTTGGTGGGAGTTCGGAATCCCAGGTCCATGTTAAGTATGGAACCAGCGGTTCCCCGCGGTCAT
TCGGCAGAGCAGTTTGTCAAATTTGGGCCGTTCTATTTGAAGAGGGGCCCCTATCCTGAAGACCCAATGGAAGGA
TACATCTTAACGCCTTCGGTGGAGACGAAACTTATTGATCTTGCGCGTATCGTTACAACCAGAAGGTTCCCTGTT
TTGATCGAAGGCCCCACTTCAAGTGGCAAGACAAGCTCCGTCGAGTATCTAGCGCGGCGAACTGGTCATCGCTTT
GTCCGTATCAATAACCATGAACATACAGACATTCAAGAGTATCTTGGCTCCTACGTGTCAGATCCTCTGACTGGC
AAGCTCGTTTTCAAAGATGGCCTCCTTGTGCATGCCTTGCGGAATGGGGATTGGATCGTCCTAGACGAACTGAAT
TTGGCTCCAACTGACGTCTTGGAAGCCCTCAACCGGCTTCTTGATGACAACCGAGAGCTTCTTATTCCGGAGACT
CAAGAAGTGATACGGCCTCATCCACAATTCATGTTGTTCGCAACTCAAAACCCTCCCGGCCTCTACGCTGGCAGA
AAAATCCTATCTCGTGCGTTCCGTAACCGATTTCTTGAAGTACATTTCCAGGATGTCCCACAAGCTGAATTGGAG
TCGATCTTGTGTCAACGTTGCAAGATCGCTCCCTCTTATGGTAAACGCATCGTCGCCGTATTCCAAGAGTTGCAA
AAACGGCGTCAGGCTGGTCGTGTCTTTGAAAGCAAGCAAGGTTTTGCTACTCTTCGGGATTTATTCCGTTGGGCC
AATAGAGATGCTCTTGGTTATCAAGAATTGGCTGACAATGGATATATGCTGCTAGCAGAACGTGCACGTCGAGAC
GATGACAAAGCTGTTGTCAAGGAGGTGATTCAATCCATCATGGGGGCGCAAATCAACGAAGATGTCCTTTATAAC
CTCCATCAGCCAAGTGTGAACATGCCCGAGTTTTTGGGTACACCATTACCATTGACATCTGACGTCGTCTGGACG
AAAGCCATGCAACGCTTATATATCTTGCTCTGTCGTGCGCTCAAGTTCAACGAGCCCGTTTTGTTGGTTGGGGAA
ACAGGCTCCGGGAAGACTTCCGTCTGCCAGATCTTCGCCGAAGCTACCGGGCAGCGGCTACATGGACTCAATTGT
CATCAAAACACTGAAACTGCAGACATTATCGGCGCTCTGCGCCCCGTTCGAAATCGGACTGCATTAGAAGCAGAA
GTATTTCAAGAAGCGTCTTCGGCATTAGCAGCGAGTGGTGTGCAGCCCACTGACTCATCCTTTGAAGGGCTTGCC
TCTGCGCTGGAAAAAGCTTTAAAATTGTCTTGCTCCACATATCATGGTTTACTATCCCATGCTCGAAGTCGCCTG
CTTGGGCTTCAATCTATTTTTGAGTGGCATGACGGTCCTCTCGTCGAAGCCATGGGGCGTGGTGACATATTCTTG
CTTGATGAAATCTCTTTGGCCGATGACTCGGTGCTGGAGCGGTTGAACAGCGTACTGGAACCTGCTCGTACCATT
GTTCTTGCCGAAAAGGGAGGAAGCGATTTTGTGCATCCAGTTGTTAAGGCTATGGACGCTTTCAAGTTAGTTGCG
ACAATGAATCCAGGTGGTGACTATGGAAAGAAGGAATTATCACCAGCATTGCGCAATCGTTTCACAGAGATCTGG
GTACCACGTGTGGATCGTCGTGCTGACTTGGAGTTAATTGTGGGCAGTCTCTGGAAACATGCAAATCTTAGACCC
TATACACAAAAAGTGCTCGATTATACGGAGTGGTTATCTTCAAGGGTTGGGGACCGGTCCATAGCAAGTTTGCGT
GACATTATAGCTTGGGTTATGTTCTCTAATGCTGTCTACACGGTTGAAGGAGCTATCTCGTCCTCCGGGGTTTTT
CACCATGCAGCACAAATGACGTACCTTGATGGACTAGCTTCCCTTCCCCAGTTGTCTGCGTATTCTCGTGACGCT
CTGACTCGACTCAAGGAAGAAGCTACGAGGAAACTAAATGAGATGGTGCCTCTTACCGATACCAATTTCCATGAA
CCAGTCTTCGATCCCACTCAATTTGTTCAGTTTGGCTCGTTCGGGATCAAGAAAGGTTCACTTGAAACAGAACCC
CTGGTTTTCAATCTGGCTGCTCCTACGTCGCGGAGTAACGCTATGCGCATCTTACGTGCCTGCCAGTTATCAAAG
CCTGTTCTCCTTGAAGGCAGTCCTGGAGTCGGAAAAACGAGTTTAATCACTGCTCTCGCGAATATCTCGGGTCAC
CACCTCTGCCGCATCAATTTATCCGATCAAACTGATCTTATCGACCTTTTTGGTTCCGACCTTCCCGTTGAGGGT
GGCTCACCAGGTGAGTTCGCCTGGAGAGATGCAGAATTCCTCAAGGCGCTACAGCATGGCCATTGGGTACTTCTG
GACGAGATGAACCTGGCGCCCCAAACTGTGCTCGAGGGTCTCAATGCTGTTCTCGATCATCGAGGAACGGTTTAT
ATTCCAGAATTGGGAAAAACATTCACTTGTCATCCATCATTCCGAATCTTTGCAGCTCAAAACCCTATAAACCAG
GGGGGTGGCCGCAAAGGCTTGCCCAAATCTTTTGTCAATCGATTTACCAAAGTCTACATCGAGGAACTTACTTCT
GCCGACCTCACCTTGGTTTGCCAGCATATGTTTCCTGATATGGATGAAAACGTTCTTCATGCCATGATTGCTTTT
AATAACAGTCTCAACGACGAAGTTACACATCGGAAAACCTTCGGTCGCGCTGGTGCACCTTGGGAATTCAATCTT
CGCGATGTCATTCGATGGGGTCGCCTTCTGAGTTCGTACCGTAACAGAGCACCCGTCACCTTCCTTCGAAGCGTA
TACCTCCAGCGATTTCGTACCAATGAAGACCGCCGTCGCGTGCAAGGCATATTCGACGCCATCTTTACTTCTTCG
ACGCCATCATTTGAGCAAGCTCCTCCCTCATTCTTCTCTCCCTCAGAGCTGCAAGTTGGTCACTTCTCAACCACG
CGTCATAATTTTTCTACATTATCTCGCCCTGAGCGTCTTCTCAAGGTTCAAACCGCACCCATGGAGACCCTTGGC
GACTGTGTCTCGCAGAACTGGCTAGCTATTGTTACCGGTCCCCGTGACAGTGGTAAGTCTCACTTGATTCGGGCT
TTGGCTAATTTTACAGGCAATCCACTTCGTGAGATATCCATGAATAGCGCCACGGACACCATGGATATAATTGGC
AGTTTTGAGCAGGTTGATGTTCGGGCGCTAGCTATCGATCTCATTCACGACATCTTGCAACTCGCCGAAGAAGAT
TTTAGAAATCCGAAACAGGCTCAAGAGCTACATGATCTCATAGCCACGCGAGACTCACTGAACCTAGCGGTATCA
GGCCCTCTGACTCAAGAAATGATTGTTTCTTTGCTGGGACAGGCTTCTGACTTTCTCTCCGATCTTACTAATCAC
TGTGGTGCTTCCGGGGAGGTTCAGCAACGCATCAAAACACTCTTGCAGTCACCATGGGTGGGACGCTTTGAATGG
ATGGATGGACCTTTGGTTCAGGCAATGCGTCAAGGTAAATGGCTGCTTTTGGACGGTGCCAATCTCTGCAATCCT
TCTGTACTGGACCGCCTCAATTCCCTCTGTGAGCCCAACGGCCAATTGACTTTGAATGAACGTGGTCTCGTGCAA
GACGTGATTGAGGTTATCAAACCGCACCCTAATTTCCGATTGTTTATGACGGTCGATCCTCAACACGGTGAACTA
TCGAGGGCTATGCGAAATCGGGGTATTGAGATATTCATCCCCTTGGGTATCCTTCCCGATGACTATCTAATTGTT
TCGGATCACCTGCGCCTACCTCGTCTTCAAACTCCTGTTGAGCACGCAAATCTGCTGTCACTGAATCATCTGTCT
TCTAGGAGAGGCCTAGCAAAGTCATTGTACCAACGAGAGAAAATCACTACTTCTTCAGGACGATCACTCGACCAC
TTTACTCCTCTATCCAACGTAATGGATCGCTTCCCCTTGTACCTTAACGCCTCAAATGATATGTATCTTGATGCA
TCGACTTTCTTCCTGTCTCGTACTTTCCACCCTGCGTATTTCCCGTACTTTCGTCGAGTTTTGGACACATGTGAT
GGTACAAATGGACAATTGAAGCAATATCTTCATGCTTTCGTGAATTTGTTGTCAAGCCCCCCATCATTATCCGTC
ACCAGTCGCATTAAGGACATGTTAACACAAGTGAGAAAGTGTTCGTCTGAGATCTTGTCTGCCCAGGCCATGGAC
GACTTTGCCAATGAGTTGTCAACAAGCTTTACTGAGTCCGATGCAGACGCAGTCCTGAACATTCTAGACTTCATT
GCAGCTGTTTTCCTCCAACGCGAAAATACAGGCCCCGATGGTTACGAGCCTCGTTTTTCGACTCCGATGGTTGAG
AGGATACATCAGGCAATTAAAAATTTCTTGGACCAATTATCTCGCCTCAACGAACATATCTTAAACACGCTCTCT
TCTGATGCTGACATCGTCGAAGTACTAAACGCATTACCCTTGGTTCTCGCTGTTAACAAATGCGGGCGATTCCTT
CATACCATTTCATCTCAGGCCCTTCTTAATCATTCAGCTGTTCAAGTGGTGGTTCGCATGATCAGAGATGTGTTA
AATGGTGCACCACCTCTACTCCTTTCCCTTTCTACTGATGCGACTTATGGTTACGGTGGAGTTGTAAAGATGCAC
TGCCAACCGGCGATTCGTGGGGGGTACGATTAG
Transcript >Agabi119p4|681500
ATGACTTCAGCTGGTGTTCCTGGCACCGACGCTTCTATCGCAACTCAAATCCCAACTACTACAAAAATCGAGTGG
CCAGAACTCGAACCCGAATCATCTGCATTCTCAGATGAATCCATGGCAGCAACCGCTGTTCTTTTTACATCTCCC
AATACAACAGCTACATTTGATGCAAGTCTTCTTCGTGACCCACTCAAAATCAACTTGAAGCAACAAATTAAAAAG
TTGATTGTTGCCATTCAACATTCGACAATCGAATCCCGTTTACCTACTGTTCTGGAAAATTTCAACTCGTTTGCT
TGTGGTCTTCGTGCTGTGGTCGAGAGAAAAGTCTTGTTGGATGCAGTGTCGAGGTGTCTGAGCGTACCTCAGTTG
CTTGAGACTGTTGTGGATTTGTTCAGGCCGCTGTTAATCGATTTGGTTGCGAGGTGGTTGGACGATGAAAAGGTC
GATGGAGAGGTGAAGGAGGAGAGGTTGATTGCTTTGACTTATATCGTTGAGGTTTATGAGGAAATCTTCCCGATA
TTTCACGAATTTTTGACCAAATTTTACCCTGATGGCCCACTTGCAGCTAGCGCCACACAATCCAGTACACCCTTC
GGAGAGGTTGAACGATTACACCGTCTCCTTTTGACATATTTCCGCATTCAACAAGCCAACCGCGAACTCCCTCTT
CAACTGTTCTGGAGTTTAACGCCGCTCAGCAAACTTATATGGTCATCTAACCATAATCAAGATGATAATGGAGTT
AAATTACTCGCTATCCGATGTTACGCTTATCAAAGTGGAATGGGTGAGGCGGAGAGAGAGAAGATGGAGAGGAAA
GTTCTGAATATGAAAGACGATGAAATGTGCAGCGTTGATTGTTGGATTTCCGCTGGTGGTTTCGGGAAGAAGGAT
GAGGAGGGGAAGGAAAGGCTCTTGGATGGCTGGGTGTTGCCTATGCTAGAGGTACAGAGAGTTAAGGATATGAGG
GAGGGGCTATATGATGTTGATTTAGAGACGTTCTACGGATTTGAGGATGAAGAAGAGAGAGTATGTGTTGAAGAG
CTCGATTTGAGTCCTCGTGTTGCGAACATTCATGGCGTCTTACTCCTTCGACAGTCCACGGCGCCCGCGCGTCCC
TCGGTGCTTATAGCTACGCCTACTTCTATCAGGTCTCTCCAGGCTCTTGCTCTTCATATATCCATGCGTGCTCCT
ACGCTCCTCACATCATCACCGTCCGCTGGAAAAAGTCTTTTGCTAGATCATCTTGCCCGGTCACTTTATCCCGAC
ACCGAGAACCAAATCATTACTATTCATCTCGCTGATACATCACTCGATCCTCGATCTCTACTCGGTTCATACATC
TCTTCTTCAACTCAACCTGGGAGTTTTGAATGGAAAGAGGGTGTCCTGGTGCGCGCAATGCGTGAAGGTCGTTGG
GTAGTCTTTGAAGATATTGATCGAGGAAGTAATGAAGTTCTTGGAGTCATCAAACCTCTCGTTGAGTCACTGCGG
CTCGGAAATTGGATAGGTGCGCGAGCAAAGGTGGATGTTCCATCCAGAGGAACTATCGTTGCACATCAGAATTTT
CTGGTGTTTGCAACCCGTTCTTTACAACCATCGAGAAATGGGAAATTTGTTCAACCAACTTTTTTTGGTGCCCAC
AAGTTTTGCGAGACGATCATTAGAGCTCCAGAGGGAGACGAGCTGAAGATGATAATAGAGAGACGGTGTGTGAGG
TTGGGAAGCAATGCTGTGGAGGGGTTGATTGATCTTTGGACAGAAGTGAAGGCGTTGGGGATGGTGGCGAGTGTG
AGGGATGTTGGATTAAGGGAGCTGGAAAAGTTGTGTGCTAGAGTGGAGAGGCTGTTACCAATGTCGGATCAGTCA
ATGGACATTGATCCATCAGAAGGAGGCATTGTGCCGCTTTGGAATATCTTCACAAATCCTTCGTTGAGAGAGGAG
ATATATCTGGAGGCACGGGACGTGTTCTTCGGCGCGAGCGCAACGACTACCTCAGCCAAGAATCATTTTGATAGT
GTTGCTGCCATTGTTGGCAAGAAACTTGGTTTGGATGAAGAAAGACAAGAATGGTTGCTGAAAGGAAGGGTATTT
GTTTTGGATATCGAGAAGGATGTGAATGGGAACATCAGTGGTGTATCCATAGGGAGAACAAGATTGGCTGCGAAG
CAGAGGAAGAGTTTAGTTGATCTACCACCTTCAAGACCTTTCGCTATGCATCGCCCCGCTGTGTGTCTACTCTCT
CGTATTATGACGAGCGTGGCACTCTCCGAACCTGTCTTACTCACCGGTGAGACGGGTACAGGAAAAACTAGTGTC
GTCACGCATTTAGCGTCTTTGCTTGGGCGTTCGCTTATCTCTCTCAACTTGTCCCATCAGACAGAATCATCGGAT
TTGATTGGTGGATTGAAGCCTATTGATACGAGGGTTCCCGCGTCTGTGCTTCAAGAAAGATTCTTGGAGTTATTT
GGGTCCACTTTTAGTAGGAAGAAGAATGAGAAGTTCGAGTCGGAGGTTAGGAAAGCTGTGAACGAAGGAAGATGG
AAGAGAGTTGTGGGACTTTGGAAGGAGAGCGGAAGATTGGCTAGGGAGCGTTTGACGGCGAGAAAGGCCGAACGG
ATGAGCGAGGCTGATCATGGACGTGGTGAACCTGAGGCCCCTCGTAAGCGGAGGAAGTTTAATGCTGTAGAATCC
ATTGCTGTATGGGATACTTTTTTGAAGGACGTCGATGAATTCGATATCCAGCACGTGCAAGGAAAAGGCAAATTT
GCTTTTGGATTCGTAGAAGGTCCTTTGGTCAAGGCATTACGGTCAGGCGATTGGATCTTGCTGGACGAAATTAAC
CTTGCAAGCCCAGAAACCCTCGAATGTATCTCCGGATTACTCCATGGTCCAACTGCATCCATTACCCTCACGGAG
CAAGGATCCCTTGAGCCTGTACCTCGCCACCCAGATTTCCGGCTATTTGCCTGCATGAACCCGGCAACTGATGTC
GGCAAGAAAGATCTCCCCCCGAATATCCGTTCCCGGTTTACCGAGATCGACGTTCCGCCACCAGATGCTGATAAA
GATACACTCTTGACCATAATCACCCAATATATCGGAGCATGTGCAGTTGGAGACAAAGGGATCATTATGAACGTG
GCAGAGTTTTATATCGCCGCCAAAGGTCTGGCCGGGAAGCGCCAGCTCGCAGATGGTGCCAACCATAGACCACAT
TTTAGTATGCGGACATTGGCACGTGCGTTGACCTTCGCTTCTGATATGGCAAATATGTATAGTTTGCGTCGGGCT
GTTTGGGAGGGTTGTTTGATGGCTTTTACGATGGTTTTGGATCCATCGAGTGCGGAGATTTTGGTGGGGCTAATG
CACAAACACTTGTTGGTGGGAGTTCGGAATCCCAGGTCCATGTTAAGTATGGAACCAGCGGTTCCCCGCGGTCAT
TCGGCAGAGCAGTTTGTCAAATTTGGGCCGTTCTATTTGAAGAGGGGCCCCTATCCTGAAGACCCAATGGAAGGA
TACATCTTAACGCCTTCGGTGGAGACGAAACTTATTGATCTTGCGCGTATCGTTACAACCAGAAGGTTCCCTGTT
TTGATCGAAGGCCCCACTTCAAGTGGCAAGACAAGCTCCGTCGAGTATCTAGCGCGGCGAACTGGTCATCGCTTT
GTCCGTATCAATAACCATGAACATACAGACATTCAAGAGTATCTTGGCTCCTACGTGTCAGATCCTCTGACTGGC
AAGCTCGTTTTCAAAGATGGCCTCCTTGTGCATGCCTTGCGGAATGGGGATTGGATCGTCCTAGACGAACTGAAT
TTGGCTCCAACTGACGTCTTGGAAGCCCTCAACCGGCTTCTTGATGACAACCGAGAGCTTCTTATTCCGGAGACT
CAAGAAGTGATACGGCCTCATCCACAATTCATGTTGTTCGCAACTCAAAACCCTCCCGGCCTCTACGCTGGCAGA
AAAATCCTATCTCGTGCGTTCCGTAACCGATTTCTTGAAGTACATTTCCAGGATGTCCCACAAGCTGAATTGGAG
TCGATCTTGTGTCAACGTTGCAAGATCGCTCCCTCTTATGGTAAACGCATCGTCGCCGTATTCCAAGAGTTGCAA
AAACGGCGTCAGGCTGGTCGTGTCTTTGAAAGCAAGCAAGGTTTTGCTACTCTTCGGGATTTATTCCGTTGGGCC
AATAGAGATGCTCTTGGTTATCAAGAATTGGCTGACAATGGATATATGCTGCTAGCAGAACGTGCACGTCGAGAC
GATGACAAAGCTGTTGTCAAGGAGGTGATTCAATCCATCATGGGGGCGCAAATCAACGAAGATGTCCTTTATAAC
CTCCATCAGCCAAGTGTGAACATGCCCGAGTTTTTGGGTACACCATTACCATTGACATCTGACGTCGTCTGGACG
AAAGCCATGCAACGCTTATATATCTTGCTCTGTCGTGCGCTCAAGTTCAACGAGCCCGTTTTGTTGGTTGGGGAA
ACAGGCTCCGGGAAGACTTCCGTCTGCCAGATCTTCGCCGAAGCTACCGGGCAGCGGCTACATGGACTCAATTGT
CATCAAAACACTGAAACTGCAGACATTATCGGCGCTCTGCGCCCCGTTCGAAATCGGACTGCATTAGAAGCAGAA
GTATTTCAAGAAGCGTCTTCGGCATTAGCAGCGAGTGGTGTGCAGCCCACTGACTCATCCTTTGAAGGGCTTGCC
TCTGCGCTGGAAAAAGCTTTAAAATTGTCTTGCTCCACATATCATGGTTTACTATCCCATGCTCGAAGTCGCCTG
CTTGGGCTTCAATCTATTTTTGAGTGGCATGACGGTCCTCTCGTCGAAGCCATGGGGCGTGGTGACATATTCTTG
CTTGATGAAATCTCTTTGGCCGATGACTCGGTGCTGGAGCGGTTGAACAGCGTACTGGAACCTGCTCGTACCATT
GTTCTTGCCGAAAAGGGAGGAAGCGATTTTGTGCATCCAGTTGTTAAGGCTATGGACGCTTTCAAGTTAGTTGCG
ACAATGAATCCAGGTGGTGACTATGGAAAGAAGGAATTATCACCAGCATTGCGCAATCGTTTCACAGAGATCTGG
GTACCACGTGTGGATCGTCGTGCTGACTTGGAGTTAATTGTGGGCAGTCTCTGGAAACATGCAAATCTTAGACCC
TATACACAAAAAGTGCTCGATTATACGGAGTGGTTATCTTCAAGGGTTGGGGACCGGTCCATAGCAAGTTTGCGT
GACATTATAGCTTGGGTTATGTTCTCTAATGCTGTCTACACGGTTGAAGGAGCTATCTCGTCCTCCGGGGTTTTT
CACCATGCAGCACAAATGACGTACCTTGATGGACTAGCTTCCCTTCCCCAGTTGTCTGCGTATTCTCGTGACGCT
CTGACTCGACTCAAGGAAGAAGCTACGAGGAAACTAAATGAGATGGTGCCTCTTACCGATACCAATTTCCATGAA
CCAGTCTTCGATCCCACTCAATTTGTTCAGTTTGGCTCGTTCGGGATCAAGAAAGGTTCACTTGAAACAGAACCC
CTGGTTTTCAATCTGGCTGCTCCTACGTCGCGGAGTAACGCTATGCGCATCTTACGTGCCTGCCAGTTATCAAAG
CCTGTTCTCCTTGAAGGCAGTCCTGGAGTCGGAAAAACGAGTTTAATCACTGCTCTCGCGAATATCTCGGGTCAC
CACCTCTGCCGCATCAATTTATCCGATCAAACTGATCTTATCGACCTTTTTGGTTCCGACCTTCCCGTTGAGGGT
GGCTCACCAGGTGAGTTCGCCTGGAGAGATGCAGAATTCCTCAAGGCGCTACAGCATGGCCATTGGGTACTTCTG
GACGAGATGAACCTGGCGCCCCAAACTGTGCTCGAGGGTCTCAATGCTGTTCTCGATCATCGAGGAACGGTTTAT
ATTCCAGAATTGGGAAAAACATTCACTTGTCATCCATCATTCCGAATCTTTGCAGCTCAAAACCCTATAAACCAG
GGGGGTGGCCGCAAAGGCTTGCCCAAATCTTTTGTCAATCGATTTACCAAAGTCTACATCGAGGAACTTACTTCT
GCCGACCTCACCTTGGTTTGCCAGCATATGTTTCCTGATATGGATGAAAACGTTCTTCATGCCATGATTGCTTTT
AATAACAGTCTCAACGACGAAGTTACACATCGGAAAACCTTCGGTCGCGCTGGTGCACCTTGGGAATTCAATCTT
CGCGATGTCATTCGATGGGGTCGCCTTCTGAGTTCGTACCGTAACAGAGCACCCGTCACCTTCCTTCGAAGCGTA
TACCTCCAGCGATTTCGTACCAATGAAGACCGCCGTCGCGTGCAAGGCATATTCGACGCCATCTTTACTTCTTCG
ACGCCATCATTTGAGCAAGCTCCTCCCTCATTCTTCTCTCCCTCAGAGCTGCAAGTTGGTCACTTCTCAACCACG
CGTCATAATTTTTCTACATTATCTCGCCCTGAGCGTCTTCTCAAGGTTCAAACCGCACCCATGGAGACCCTTGGC
GACTGTGTCTCGCAGAACTGGCTAGCTATTGTTACCGGTCCCCGTGACAGTGGTAAGTCTCACTTGATTCGGGCT
TTGGCTAATTTTACAGGCAATCCACTTCGTGAGATATCCATGAATAGCGCCACGGACACCATGGATATAATTGGC
AGTTTTGAGCAGGTTGATGTTCGGGCGCTAGCTATCGATCTCATTCACGACATCTTGCAACTCGCCGAAGAAGAT
TTTAGAAATCCGAAACAGGCTCAAGAGCTACATGATCTCATAGCCACGCGAGACTCACTGAACCTAGCGGTATCA
GGCCCTCTGACTCAAGAAATGATTGTTTCTTTGCTGGGACAGGCTTCTGACTTTCTCTCCGATCTTACTAATCAC
TGTGGTGCTTCCGGGGAGGTTCAGCAACGCATCAAAACACTCTTGCAGTCACCATGGGTGGGACGCTTTGAATGG
ATGGATGGACCTTTGGTTCAGGCAATGCGTCAAGGTAAATGGCTGCTTTTGGACGGTGCCAATCTCTGCAATCCT
TCTGTACTGGACCGCCTCAATTCCCTCTGTGAGCCCAACGGCCAATTGACTTTGAATGAACGTGGTCTCGTGCAA
GACGTGATTGAGGTTATCAAACCGCACCCTAATTTCCGATTGTTTATGACGGTCGATCCTCAACACGGTGAACTA
TCGAGGGCTATGCGAAATCGGGGTATTGAGATATTCATCCCCTTGGGTATCCTTCCCGATGACTATCTAATTGTT
TCGGATCACCTGCGCCTACCTCGTCTTCAAACTCCTGTTGAGCACGCAAATCTGCTGTCACTGAATCATCTGTCT
TCTAGGAGAGGCCTAGCAAAGTCATTGTACCAACGAGAGAAAATCACTACTTCTTCAGGACGATCACTCGACCAC
TTTACTCCTCTATCCAACGTAATGGATCGCTTCCCCTTGTACCTTAACGCCTCAAATGATATGTATCTTGATGCA
TCGACTTTCTTCCTGTCTCGTACTTTCCACCCTGCGTATTTCCCGTACTTTCGTCGAGTTTTGGACACATGTGAT
GGTACAAATGGACAATTGAAGCAATATCTTCATGCTTTCGTGAATTTGTTGTCAAGCCCCCCATCATTATCCGTC
ACCAGTCGCATTAAGGACATGTTAACACAAGTGAGAAAGTGTTCGTCTGAGATCTTGTCTGCCCAGGCCATGGAC
GACTTTGCCAATGAGTTGTCAACAAGCTTTACTGAGTCCGATGCAGACGCAGTCCTGAACATTCTAGACTTCATT
GCAGCTGTTTTCCTCCAACGCGAAAATACAGGCCCCGATGGTTACGAGCCTCGTTTTTCGACTCCGATGGTTGAG
AGGATACATCAGGCAATTAAAAATTTCTTGGACCAATTATCTCGCCTCAACGAACATATCTTAAACACGCTCTCT
TCTGATGCTGACATCGTCGAAGTACTAAACGCATTACCCTTGGTTCTCGCTGTTAACAAATGCGGGCGATTCCTT
CATACCATTTCATCTCAGGCCCTTCTTAATCATTCAGCTGTTCAAGTGGTGGTTCGCATGATCAGAGATGTGTTA
AATGGTGCACCACCTCTACTCCTTTCCCTTTCTACTGATGCGACTTATGGTTACGGTGGAGTTGTAAAGATGCAC
TGCCAACCGGCGATTCGTGGGGGGTACGATTAG
Gene >Agabi119p4|681500
ATGACTTCAGCTGGTGTTCCTGGCACCGACGCTTCTATCGCAACTCAAATCCCAACTACTACAAAAATCGAGTGG
CCAGAACTCGAACCCGAATCATCTGCATTCTCAGATGAATCCATGGCAGCAACCGCTGTTCTTTTTACATCTCCC
AATACAACAGCTACATTTGATGCAAGTCTTCTTCGTGACCCACTCAAAATCAACTTGAAGCAACAAATTAAAAAG
TTGATTGTTGCCATTCAACATTCGACAATCGAATCCCGTTTACCTACTGTTCTGGAAAATTTCAACTCGTTTGCT
TGTGGTCTTCGTGCTGTGGTCGAGAGAAAAGTCTTGTTGGATGCAGTGTCGAGGTGTCTGAGCGTACCTCAGTTG
CTTGAGACTGTTGTGGATTTGTTCAGGCCGCTGTTAATCGATTTGGTTGCGAGGTGGTTGGACGATGAAAAGGTC
GATGGAGAGGTGAAGGAGGAGAGGTTGATTGCTTTGACTTATATCGTTGAGGTTTATGAGGAAATCTTCCCGTCT
GTCCTTTCCTTTCTACCTTAAGGCTCGGTTCACTGACTGGTTTACTCGTAGGATATTTCACGAATTTTTGACCAA
ATTTTACCCTGATGGCCCACTTGCAGCTAGCGCCACACAATCCAGTACACCCTTCGGAGAGGTTGAACGATTACA
CCGTCTCCTTTTGACATATTTCCGCATTCAACAAGCCAACCGCGAACTCCCTCTTCAACTGTTCTGGAGTTTAAC
GCCGCTCAGCAAACTTATATGGTCATCTAACCATAATCAAGATGATAATGGAGTTAAATTACTCGCTATCCGATG
TTACGCTTATCAAAGTGGAATGGGTGAGGCGGAGAGAGAGAAGATGGAGAGGAAAGTTCTGAATATGAAAGACGA
TGAAATGTGCAGCGTTGATTGTTGGATTTCCGCTGGTGGTTTCGGGAAGAAGGATGAGGAGGGGAAGGAAAGGCT
CTTGGATGGCTGGGTGTTGCCTATGCTAGAGGTACAGAGAGTTAAGGATATGAGGGAGGGGCTATATGATGTTGA
TTTAGAGACGTTCTACGGATTTGAGGATGAAGAAGAGAGAGTATGTGTTGAAGAGCTCGATTTGAGGTATGGTTG
TATCCTGTCTTTTCTCCAGTGATTAACTTTCTTTGCTATAGTCCTCGTGTTGCGAACATTCATGGCGTCTTACTC
CTTCGACAGTCCACGGCGCCCGCGCGTCCCTCGGTGCTTATAGCTACGCCTACTTCTATCAGGTCTCTCCAGGCT
CTTGCTCTTCATATATCCATGCGTGCTCCTACGCTCCTCACATCATCACCGTCCGCTGGAAAAAGTCTTTTGCTA
GATCATCTTGCCCGGTCACTTTATCCCGACACCGAGAACCAAATCATTACTATTCATCTCGCTGATACATCACTC
GATCCTCGATCTCTACTCGGTTCATACATCTCTTCTTCAACTCAACCTGGGAGTTTTGAATGGAAAGAGGGTGTC
CTGGTGCGCGCAATGCGTGAAGGTCGTTGGGTAGTCTTTGAAGATATTGATCGAGGAAGTAATGAAGTTCTTGGA
GTCATCAAACCTCTCGTTGAGTCACTGCGGCTCGGAAATTGGATAGGTGCGCGAGCAAAGGTGGATGTTCCATCC
AGAGGAACTATCGTTGCACATCAGAATTTTCTGGTGTTTGCAACCCGTTCTTTACAACCATCGAGAAATGGGAAA
TTTGTTCAACCAACTTTTTTTGGTGCCCACAAGTTTTGCGAGACGATCATTAGAGCTCCAGAGGGAGACGAGCTG
AAGATGATAATAGAGAGACGGTGTGTGAGGTTGGGAAGCAATGCTGTGGAGGGGTTGATTGATCTTTGGACAGAA
GTGAAGGCGTTGGGGATGGTGGCGAGTGTGAGGGATGTTGGATTAAGGGAGCTGGAAAAGTTGTGTGCTAGAGTG
GAGAGGCTGTTACCAATGTCGGATCAGTCAATGGACATTGATCCATCAGAAGGAGGCATTGTGCCGCTTTGGAAT
ATCTTCACAAATCCTTCGTTGAGAGAGGAGATATATCTGGAGGCACGGGACGTGTTCTTCGGCGCGAGCGCAACG
ACTACCTCAGCCAAGAATCATTTTGATAGTGTTGCTGCCATTGTTGGCAAGAAACTTGGTTTGGATGAAGAAAGA
CAAGAATGGTTGCTGAAAGGAAGGGTATTTGTTTTGGATATCGAGAAGGATGTGAATGGGAACATCAGTGGTGTA
TCCATAGGGAGAACAAGATTGGCTGCGAAGCAGAGGAAGAGTTTAGTTGATCTACCACCTTCAAGACCTTTCGCT
ATGCATCGCCCCGCTGTGTGTCTACTCTCTCGTATTATGACGAGCGTGGCACTCTCCGAACCTGTCTTACTCACC
GGTGAGACGGGTACAGGAAAAACTAGTGTCGTCACGCATTTAGCGTCTTTGCTTGGGCGTTCGCTTATCTCTCTC
AACTTGTCCCATCAGACAGAATCATCGGATTTGATTGGTGGATTGAAGCCTATTGATACGAGGGTTCCCGCGTCT
GTGCTTCAAGAAAGATTCTTGGAGTTATTTGGGTCCACTTTTAGTAGGAAGAAGAATGAGAAGTTCGAGTCGGAG
GTTAGGAAAGCTGTGAACGAAGGAAGATGGAAGAGAGTTGTGGGACTTTGGAAGGAGAGCGGAAGATTGGCTAGG
GAGCGTTTGACGGCGAGAAAGGCCGAACGGATGAGGTACGTTTTCTATGTTCGTTCCCTGTTTCTCGAGCTCGTG
CTTATAATTTTCATTCATAGCGAGGCTGATCATGGACGTGGTGAACCTGAGGCCCCTCGTAAGCGGAGGAAGTTT
AATGCTGTAGAATCCATTGCTGTATGGGATACTTTTTTGAAGGACGTCGATGAATTCGATATCCAGCACGTGCAA
GGAAAAGGCAAATTTGCTTTTGGATTCGTAGAAGGTCCTTTGGTCAAGGCATTACGGTCAGGCGATTGGTAAGTT
GACCATTTGCTGACTAGTGCGCACGTTAAAACTCATTTATGATTGAAGGATCTTGCTGGACGAAATTAACCTTGC
AAGCCCAGAAACCCTCGAATGTATCTCCGGATTACTCCATGGTCCAACTGCATCCATTACCCTCACGGAGCAAGG
ATCCCTTGAGCCTGTACCTCGCCACCCAGATTTCCGGCTATTTGCCTGCATGAACCCGGCAACTGATGTCGGCAA
GAAAGATCTCCCCCCGAATATCCGTTCCCGGTTTACCGAGATCGACGTTCCGCCACCAGATGCTGATAAAGATAC
ACTCTTGACCATAATCACCCAATATATCGGAGCATGTGCAGTTGGAGACAAAGGGATCATTATGAACGTGGCAGA
GTTTTATATCGCCGCCAAAGGTCTGGCCGGGAAGCGCCAGCTCGCAGATGGTGCCAACCATAGACCACATTTTAG
TATGCGGACATTGGCACGTGCGTTGACCTTCGCTTCTGATATGGCAAATATGTATAGTTTGCGTCGGGCTGTTTG
GGAGGGTTGTTTGATGGCTTTTACGATGGTTTTGGATCCATCGAGTGCGGAGATTTTGGTGGGGCTAATGCACAA
ACACTTGTTGGTGGGAGTTCGGAATCCCAGGTCCATGTTAAGTATGGAACCAGCGGTTCCCCGCGGTCATTCGGC
AGAGCAGTTTGTCAAATTTGGGCCGTTCTATTTGAAGAGGGGCCCCTATCCTGAAGACCCAATGGAAGGATACAT
CTTAACGCCTTCGGTGGAGACGAAACTTATTGATCTTGCGCGTATCGTTACAACCAGAAGGTTCCCTGTTTTGAT
CGAAGGCCCCACTTCAAGTGGCAAGACAAGCTCCGTCGAGTATCTAGCGCGGCGAACTGGTCATCGCTTTGTCCG
TATCAATAACCATGAACATACAGACATTCAAGAGTATCTTGGCTCCTACGTGTCAGATCCTCTGACTGGCAAGCT
CGTTTTCAAAGATGGCCTCCTTGTGCATGCCTTGCGGAATGGGGATTGGATCGTCCTAGACGAACTGAATTTGGC
TCCAACTGACGTCTTGGAAGCCCTCAACCGGCTTCTTGATGACAACCGAGAGCTTCTTATTCCGGAGACTCAAGA
AGTGATACGGCCTCATCCACAATTCATGTTGTTCGCAACTCAAAACCCTCCCGGCCTCTACGCTGGCAGAAAAAT
CCTATCTCGTGCGTTCCGTAACCGATTTCTTGAAGTACATTTCCAGGATGTCCCACAAGCTGAATTGGAGTCGAT
CTTGTGTCAACGTTGCAAGATCGCTCCCTCTTATGGTAAACGCATCGTCGCCGTATTCCAAGAGTTGCAAAAACG
GCGTCAGGCTGGTCGTGTCTTTGAAAGCAAGCAAGGTTTTGCTACTCTTCGGGATTTATTCCGTTGGGCCAATAG
AGATGCTCTTGGTTATCAAGAATTGGCTGACAATGGATATATGCTGCTAGCAGAACGTGCACGTCGAGACGATGA
CAAAGCTGTTGTCAAGGAGGTGATTCAATCCATCATGGGGGCGCAAATCAACGAAGATGTCCTTTATAACCTCCA
TCAGCCAAGTGTGAACATGCCCGAGTTTTTGGGTACACCATTACCATTGACATCTGACGTCGTCTGGACGAAAGC
CATGCAACGCTTATATATCTTGCTCTGTCGTGCGCTCAAGTTCAACGAGCCCGTTTTGTTGGTTGGGGAAACAGG
CTCCGGGAAGACTTCCGTCTGCCAGATCTTCGCCGAAGCTACCGGGCAGCGGCTACATGGACTCAATTGTCATCA
AAACACTGAAACTGCAGACATTATCGGCGCTCTGCGCCCCGTTCGAAATCGGACTGCATTAGAAGCAGAAGTATT
TCAAGAAGCGTCTTCGGCATTAGCAGCGAGTGGTGTGCAGCCCACTGACTCATCCTTTGAAGGGCTTGCCTCTGC
GCTGGAAAAAGCTTTAAAATTGTCTTGCTCCACATATCATGGTTTACTATCCCATGCTCGAAGTCGCCTGCTTGG
GCTTCAATCTATTTTTGAGTGGCATGACGGTCCTCTCGTCGAAGCCATGGGGCGTGGTGACATATTCTTGCTTGA
TGAAATCTCTTTGGCCGATGACTCGGTGCTGGAGCGGTTGAACAGCGTACTGGAACCTGCTCGTACCATTGTTCT
TGCCGAAAAGGGAGGAAGCGATTTTGTGCATCCAGTTGTTAAGGCTATGGACGCTTTCAAGTTAGTTGCGACAAT
GAATCCAGGTGGTGACTATGGAAAGAAGGAATTATCACCAGCATTGCGCAATCGTTTCACAGAGATCTGGGTACC
ACGTGTGGATCGTCGTGCTGACTTGGAGTTAATTGTGGGCAGTCTCTGGAAACATGCAAATCTTAGACCCTATAC
ACAAAAAGTGCTCGATTATACGGAGTGGTTATCTTCAAGGGTTGGGGACCGGTCCATAGCAAGTTTGCGTGACAT
TATAGTAGGTAATCTTGAAATGACTTTTCTGCCAATTCCTGATACACCCCATTTATAGGCTTGGGTTATGTTCTC
TAATGCTGTCTACACGGTTGAAGGAGCTATCTCGTCCTCCGGGGTTTTTGTAAGTCTTAAATCCTTAGACCCAAC
CTTTGGCTAATGAAGCTTGTAGCACCATGCAGCACAAATGACGTACCTTGATGGACTAGCTTCCCTTCCCCAGTT
GTCTGCGTATTCTCGTGACGCTCTGACTCGACTCAAGGAAGAAGCTACGAGGAAACTAAATGAGATGGTGCCTCT
TACCGATACCAATTTCCATGAACCAGTCTTCGATCCCACTCAATTTGTTCAGTTTGGCTCGTTCGGGATCAAGAA
AGGTTCACTTGAAACAGAACCCCTGGTTTTCAATCTGGCTGCTCCTACGTCGCGGAGTAACGCTATGCGCATCTT
ACGTGCCTGCCAGTTATCAAAGCCTGTTCTCCTTGAAGGCAGTCCTGGAGTCGGAAAAACGAGTTTAATCACTGC
TCTCGCGAATATCTCGGGTCACCACCTCTGCCGCATCAATTTATCCGATCAAACTGATCTTATCGACCTTTTTGG
TTCCGACCTTCCCGTTGAGGGTGGCTCACCAGGTGAGTTCGCCTGGAGAGATGCAGAATTCCTCAAGGCGCTACA
GCATGGCCATTGGGTACTTCTGGACGAGATGAACCTGGCGCCCCAAACTGTGCTCGAGGGTCTCAATGCTGTTCT
CGATCATCGAGGAACGGTTTATATTCCAGAATTGGGAAAAACATTCACTTGTCATCCATCATTCCGAATCTTTGC
AGCTCAAAACCCTATAAACCAGGGGGGTGGCCGCAAAGGCTTGCCCAAATCTTTTGTCAATCGATTTACCAAAGT
CTACATCGAGGAACTTACTTCTGCCGACCTCACCTTGGTTTGCCAGCATATGTTTCCTGATATGGATGAAAACGT
TCTTCATGCCATGATTGCTTTTAATAACAGTCTCAACGACGAAGTTACACATCGGAAAACCTTCGGTCGCGCTGG
TGCACCTTGGGAATTCAATCTTCGCGATGTCATTCGATGGGGTCGCCTTCTGAGTTCGTACCGTAACAGAGCACC
CGTCACCTTCCTTCGAAGCGTATACCTCCAGCGATTTCGTACCAATGAAGACCGCCGTCGCGTGCAAGGCATATT
CGACGCCATCTTTACTTCTTCGACGCCATCATTTGAGCAAGCTCCTCCCTCATTCTTCTCTCCCTCAGAGCTGCA
AGTTGGTCACTTCTCAACCACGCGTCATAATTTTTCTACATTATCTCGCCCTGAGCGTCTTCTCAAGGTTCAAAC
CGCACCCATGGAGACCCTTGGCGACTGTGTCTCGCAGAACTGGCTAGCTATTGTTACCGGTCCCCGTGACAGTGG
TAAGTCTCACTTGATTCGGGCTTTGGCTAATTTTACAGGCAATCCACTTCGTGAGATATCCATGAATAGCGCCAC
GGACACCATGGATATAATTGGCAGTTTTGAGCAGGTTGATGTTCGGGCGCTAGCTATCGATCTCATTCACGACAT
CTTGCAACTCGCCGAAGAAGATTTTAGAAATCCGAAACAGGCTCAAGAGCTACATGATCTCATAGCCACGCGAGA
CTCACTGAACCTAGCGGTATCAGGCCCTCTGACTCAAGAAATGATTGTTTCTTTGCTGGGACAGGCTTCTGACTT
TCTCTCCGATCTTACTAATCACTGTGGTGCTTCCGGGGAGGTTCAGCAACGCATCAAAACACTCTTGCAGTCACC
ATGGGTGGGACGCTTTGAATGGATGGATGGACCTTTGGTTCAGGCAATGCGTCAAGGTAAATGGCTGCTTTTGGA
CGGTGCCAATCTCTGCAATCCTTCTGTACTGGACCGCCTCAATTCCCTCTGTGAGCCCAACGGCCAATTGACTTT
GAATGAACGTGGTCTCGTGCAAGACGTGATTGAGGTTATCAAACCGCACCCTAATTTCCGATTGTTTATGACGGT
CGATCCTCAACACGGTGAACTATCGAGGGCTATGCGAAATCGGGGTATTGAGATATTCATCCCCTTGGGTATCCT
TCCCGATGACTATCTAATTGTTTCGGATCACCTGCGCCTACCTCGTCTTCAAACTCCTGTTGAGCACGCAAATCT
GCTGTCACTGAATCATCTGTCTTCTAGGAGAGGCCTAGCAAAGTCATTGTACCAACGAGAGAAAATCACTACTTC
TTCAGGACGATCACTCGACCACTTTACTCCTCTATCCAACGTAATGGATCGCTTCCCCTTGTACCTTAACGCCTC
AAATGATATGTATCTTGATGCATCGACTTTCTTCCTGTCTCGTACTTTCCACCCTGCGTATTTCCCGTACTTTCG
TCGAGTTTTGGACACATGTGATGGTACAAATGGACAATTGAAGCAATATCTTCATGCTTTCGTGAATTTGTTGTC
AAGCCCCCCATCATTATCCGTCACCAGTCGCATTAAGGACATGTTAACACAAGTGAGAAAGTGTTCGTCTGAGAT
CTTGTCTGCCCAGGTCGGGTTTTACACATTCACAAACACGTACGTGTCTCACTAATTGAAATAGGCCATGGACGA
CTTTGCCAATGAGTTGTCAACAAGCTTTACTGAGTCCGATGCAGACGCAGTCCTGAACATTCTAGACTTCATTGC
AGCTGTTTTCCTCCAACGCGAAAATACAGGCCCCGATGGTTACGAGCCTCGTTTTTCGACTCCGATGGTTGAGAG
GATACATCAGGCAATTAAAAATTTCTTGGACCAATTATCTCGCCTCAACGAACATATCTTAAACACGCTCTCTTC
TGATGCTGACATCGTCGAAGTACTAGTGAGTCTTCAACTGAGATAACCATCTATCAACCCTGATTCTGTTCCCTT
AGAACGCATTACCCTTGGTTCTCGCTGTTAACAAATGCGGGCGATTCCTTCATACCATTTCATCTCAGGCCCTTC
TTAATCATTCAGCTGTTCAAGTGGTGGTTCGCATGATCAGAGATGTGTTAAATGGTGCACCACCTCTACTCCTTT
CCCTTTCTACTGATGCGGTACGTCTGGAAGAGATCACGTCACCAACTTCAGGCACCTCTCTTGTAGACTTATGGT
TACGGTGGAGTTGTAAAGATGCACTGCCAACCGGCGATTCGTGGGGGGTACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail