Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|680400
Gene name
Locationscaffold_07:849339..850538
Strand-
Gene length (bp)1199
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 4.4E-24 4 261

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NTL1|S399A_XENLA Zinc transporter ZIP9-A OS=Xenopus laevis GN=slc39a9-a PE=2 SV=1 4 301 4.0E-32
sp|Q5ZIU9|S39A9_CHICK Zinc transporter ZIP9 OS=Gallus gallus GN=SLC39A9 PE=2 SV=1 4 301 9.0E-32
sp|Q9NUM3|S39A9_HUMAN Zinc transporter ZIP9 OS=Homo sapiens GN=SLC39A9 PE=2 SV=2 4 301 1.0E-31
sp|Q640S1|S39A9_XENTR Zinc transporter ZIP9 OS=Xenopus tropicalis GN=slc39a9 PE=2 SV=1 4 301 3.0E-31
sp|Q6NRM1|S399B_XENLA Zinc transporter ZIP9-B OS=Xenopus laevis GN=slc39a9-b PE=2 SV=1 4 301 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NTL1|S399A_XENLA Zinc transporter ZIP9-A OS=Xenopus laevis GN=slc39a9-a PE=2 SV=1 4 301 4.0E-32
sp|Q5ZIU9|S39A9_CHICK Zinc transporter ZIP9 OS=Gallus gallus GN=SLC39A9 PE=2 SV=1 4 301 9.0E-32
sp|Q9NUM3|S39A9_HUMAN Zinc transporter ZIP9 OS=Homo sapiens GN=SLC39A9 PE=2 SV=2 4 301 1.0E-31
sp|Q640S1|S39A9_XENTR Zinc transporter ZIP9 OS=Xenopus tropicalis GN=slc39a9 PE=2 SV=1 4 301 3.0E-31
sp|Q6NRM1|S399B_XENLA Zinc transporter ZIP9-B OS=Xenopus laevis GN=slc39a9-b PE=2 SV=1 4 301 3.0E-31
sp|Q8BFU1|S39A9_MOUSE Zinc transporter ZIP9 OS=Mus musculus GN=Slc39a9 PE=2 SV=1 4 301 4.0E-31
sp|Q5BL29|S39A9_DANRE Zinc transporter ZIP9 OS=Danio rerio GN=slc39a9 PE=2 SV=1 10 301 2.0E-30
sp|Q3KR82|S39A9_RAT Zinc transporter ZIP9 OS=Rattus norvegicus GN=Slc39a9 PE=2 SV=1 4 261 5.0E-28
sp|Q95JP5|S39A9_MACFA Zinc transporter ZIP9 OS=Macaca fascicularis GN=SLC39A9 PE=2 SV=1 99 301 2.0E-18
sp|Q5RE57|S39A9_PONAB Zinc transporter ZIP9 OS=Pongo abelii GN=SLC39A9 PE=2 SV=1 142 301 3.0E-17
sp|Q12067|ATX2_YEAST Metal homeostasis factor ATX2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATX2 PE=1 SV=1 28 238 6.0E-09
sp|Q5RE57|S39A9_PONAB Zinc transporter ZIP9 OS=Pongo abelii GN=SLC39A9 PE=2 SV=1 4 62 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 4 21 17
2 28 50 22
3 65 87 22
4 142 164 22
5 179 201 22
6 213 235 22
7 240 262 22
8 278 300 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|680400
MAGALGVSSFVSGMIPLAATFSKRLLDVFNALATGLLLGTALGVIIPEGIEVLVESFEDSEALTFHIAIDLILGF
LLMMIVEHIVSGGDHQHSHHGAGTQLEFEAELGELENSLNGHHDRGRRESDISKGSTTLISAKQRAIPFTFGLIL
HGIADGCALGVSAIETTSSESESISSLSVIVFLALLFHKAPTSVAFSIALLNTSLPRHECRKYLAIFAASTPLGA
IATYFLLSFLGFADNAQLAGSGLLVSGGTFLYVATVLQPMSHQPDSQDINPKLRLGLVVIGTLTPFMLGLLIGHG
H*
Coding >Agabi119p4|680400
ATGGCGGGCGCTCTCGGCGTCTCGTCCTTTGTCTCCGGGATGATTCCGCTCGCTGCCACATTCTCCAAAAGACTT
TTGGACGTATTCAACGCCCTAGCTACTGGTCTACTTTTAGGAACTGCTCTTGGTGTTATTATTCCGGAGGGTATT
GAGGTCCTTGTGGAATCCTTCGAGGATTCCGAAGCACTCACATTTCATATTGCCATTGACCTCATTCTTGGGTTC
TTGTTAATGATGATCGTTGAACATATTGTTTCTGGAGGTGATCACCAGCACTCACATCATGGTGCTGGAACTCAG
CTCGAATTCGAAGCTGAGCTGGGAGAGCTGGAAAATAGTCTCAATGGACATCATGACCGCGGTAGAAGAGAGTCA
GATATCTCCAAAGGGTCAACTACCCTTATATCAGCAAAACAGAGAGCTATTCCATTTACCTTTGGACTTATACTC
CATGGAATAGCAGACGGCTGTGCATTGGGTGTATCCGCAATCGAGACAACTTCATCAGAATCCGAAAGTATCAGC
AGCCTCTCAGTCATCGTGTTTTTGGCATTATTATTCCACAAAGCCCCGACATCCGTGGCATTTTCTATAGCCCTT
CTAAACACTTCTCTCCCCCGCCATGAATGTAGAAAATATCTCGCAATATTCGCCGCTTCAACTCCTTTGGGTGCC
ATAGCAACATACTTTCTTCTCTCCTTCCTTGGTTTTGCCGATAATGCTCAGTTAGCAGGGTCTGGTCTTTTGGTT
TCCGGTGGAACTTTTCTATACGTCGCCACGGTTTTGCAACCCATGTCGCATCAACCCGATTCCCAGGACATAAAC
CCAAAGTTGAGACTGGGCCTTGTGGTGATAGGAACTCTGACTCCTTTCATGCTGGGCTTACTCATCGGACATGGG
CACTGA
Transcript >Agabi119p4|680400
ATGGCGGGCGCTCTCGGCGTCTCGTCCTTTGTCTCCGGGATGATTCCGCTCGCTGCCACATTCTCCAAAAGACTT
TTGGACGTATTCAACGCCCTAGCTACTGGTCTACTTTTAGGAACTGCTCTTGGTGTTATTATTCCGGAGGGTATT
GAGGTCCTTGTGGAATCCTTCGAGGATTCCGAAGCACTCACATTTCATATTGCCATTGACCTCATTCTTGGGTTC
TTGTTAATGATGATCGTTGAACATATTGTTTCTGGAGGTGATCACCAGCACTCACATCATGGTGCTGGAACTCAG
CTCGAATTCGAAGCTGAGCTGGGAGAGCTGGAAAATAGTCTCAATGGACATCATGACCGCGGTAGAAGAGAGTCA
GATATCTCCAAAGGGTCAACTACCCTTATATCAGCAAAACAGAGAGCTATTCCATTTACCTTTGGACTTATACTC
CATGGAATAGCAGACGGCTGTGCATTGGGTGTATCCGCAATCGAGACAACTTCATCAGAATCCGAAAGTATCAGC
AGCCTCTCAGTCATCGTGTTTTTGGCATTATTATTCCACAAAGCCCCGACATCCGTGGCATTTTCTATAGCCCTT
CTAAACACTTCTCTCCCCCGCCATGAATGTAGAAAATATCTCGCAATATTCGCCGCTTCAACTCCTTTGGGTGCC
ATAGCAACATACTTTCTTCTCTCCTTCCTTGGTTTTGCCGATAATGCTCAGTTAGCAGGGTCTGGTCTTTTGGTT
TCCGGTGGAACTTTTCTATACGTCGCCACGGTTTTGCAACCCATGTCGCATCAACCCGATTCCCAGGACATAAAC
CCAAAGTTGAGACTGGGCCTTGTGGTGATAGGAACTCTGACTCCTTTCATGCTGGGCTTACTCATCGGACATGGG
CACTGA
Gene >Agabi119p4|680400
ATGGCGGGCGCTCTCGGCGTCTCGTCCTTTGTCTCCGGGATGATTCCGCTCGCTGCCACATTCTCCAGTACGTCA
TTACGAACGATCGTCTGCCGAGCTTAATCCACAATCGGATGCAATAGAAAGACTTTTGGACGTATTCAACGCCCT
AGCTACTGGTCTACTTTTAGGAACTGCTCTTGGTGTTATTATTCCGGAGTATGTCGTTGTACCTCGAATTAGGCT
ATTAACTGAAGTCTTGGTACGAAAACCAGGGGTATTGAGGTCCTTGTGGAATCCTTCGAGGATTCCGAAGCACTC
ACATTTCATATTGCCATTGACCTCATTCTTGGGTTCTTGTTAATGATGATCGTTGAACATATTGTTTCTGGAGGT
GATCACCAGCACTCACATCATGGTGCTGGAACTCAGCTCGAATTCGAAGCTGAGCTGGGAGAGCTGGAAAATAGT
CTCAATGGACATCATGACCGCGGTAGAAGAGAGTCAGATATCTCCAAAGGGTCAACTACCCTTATATCAGCAAAA
CAGAGAGCTATTCCATTTACCTTTGGACTTATACTCCATGGAATAGCAGACGGCTGTGCATTGGGTGTATCCGCA
ATCGAGACAACTTCATCAGAATCCGAAAGTATCAGCAGCCTCTCAGTCATCGTGTTTTTGGCATTATTATTCCAC
AAAGGCAAGAGAGTATATAACTTCCCTACCTGCTTAACTAACTTGTACTTATTAGCCCCGACATCCGTGGCATTT
TCTATAGCCCTTCTAAACACTTCTCTCCCCCGCCATGAATGTAGAAAATATCTCGCAATATTCGCCGCTTCAACT
CCTTTGGGTGCCATAGCAACATACTTTCTTCTCTCCTTCCTTGGTTTTGCCGATAATGCTCAGTTAGCAGGGTCT
GGTCTTTTGGTTTCCGTGAGTATCCAAGTTGTAATGGGCATCCTCTCTTGCCAACTTAGGCACGGGAAACCCGTT
GTCCTAGTCTTTCTTTCTTCCGCATCTTTTGTCTCAACCATGGCACTAATTAACGTTTATAATCTTCGTAGGGTG
GAACTTTTCTATACGTCGCCACGGTTTTGCAACCCATGTCGCATCAACCCGATTCCCAGGACATAAACCCAAAGT
TGAGACTGGGCCTTGTGGTGATAGGAACTCTGACTCCTTTCATGCTGGGCTTACTCATCGGACATGGGCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail