Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|679400
Gene name
Locationscaffold_07:685263..687055
Strand+
Gene length (bp)1792
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 5.5E-59 24 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT32|RL1DB_SCHPO Putative ribosome biogenesis protein C8F11.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8F11.04 PE=3 SV=1 1 242 2.0E-38
sp|Q8BVY0|RL1D1_MOUSE Ribosomal L1 domain-containing protein 1 OS=Mus musculus GN=Rsl1d1 PE=1 SV=1 15 242 2.0E-32
sp|Q5RCE6|RL1D1_PONAB Ribosomal L1 domain-containing protein 1 OS=Pongo abelii GN=RSL1D1 PE=2 SV=2 15 247 2.0E-31
sp|O76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 OS=Homo sapiens GN=RSL1D1 PE=1 SV=3 15 247 2.0E-31
sp|A4FV97|RL1D1_BOVIN Ribosomal L1 domain-containing protein 1 OS=Bos taurus GN=RSL1D1 PE=2 SV=1 15 242 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT32|RL1DB_SCHPO Putative ribosome biogenesis protein C8F11.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8F11.04 PE=3 SV=1 1 242 2.0E-38
sp|Q8BVY0|RL1D1_MOUSE Ribosomal L1 domain-containing protein 1 OS=Mus musculus GN=Rsl1d1 PE=1 SV=1 15 242 2.0E-32
sp|Q5RCE6|RL1D1_PONAB Ribosomal L1 domain-containing protein 1 OS=Pongo abelii GN=RSL1D1 PE=2 SV=2 15 247 2.0E-31
sp|O76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 OS=Homo sapiens GN=RSL1D1 PE=1 SV=3 15 247 2.0E-31
sp|A4FV97|RL1D1_BOVIN Ribosomal L1 domain-containing protein 1 OS=Bos taurus GN=RSL1D1 PE=2 SV=1 15 242 6.0E-30
sp|Q9Y7R7|RL1DA_SCHPO Putative ribosome biogenesis protein C306.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC306.07c PE=3 SV=1 9 269 9.0E-28
sp|P36144|RL1D1_YEAST Ribosome biogenesis protein UTP30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP30 PE=1 SV=1 64 241 5.0E-14
sp|P38779|CIC1_YEAST Proteasome-interacting protein CIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIC1 PE=1 SV=1 81 258 2.0E-09
sp|Q9VLK2|Y3096_DROME Ribosomal L1 domain-containing protein CG13096 OS=Drosophila melanogaster GN=CG13096 PE=1 SV=1 11 241 2.0E-08
sp|Q7RZS0|RL10A_NEUCR 60S ribosomal protein L10a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-74 PE=3 SV=1 133 235 2.0E-08
sp|O74836|RL1B_SCHPO 60S ribosomal protein L1-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl101 PE=1 SV=1 133 235 5.0E-07
sp|O14363|RL1A_SCHPO 60S ribosomal protein L1-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl102 PE=1 SV=1 133 232 1.0E-06
sp|P59230|R10A2_ARATH 60S ribosomal protein L10a-2 OS=Arabidopsis thaliana GN=RPL10AB PE=1 SV=1 133 232 6.0E-06
sp|Q8VZB9|R10A1_ARATH 60S ribosomal protein L10a-1 OS=Arabidopsis thaliana GN=RPL10AA PE=1 SV=1 133 232 6.0E-06
sp|B7F845|R10A_ORYSJ 60S ribosomal protein L10a OS=Oryza sativa subsp. japonica GN=RPL10A PE=1 SV=1 133 234 6.0E-06
sp|B8B9K6|R10A_ORYSI 60S ribosomal protein L10a OS=Oryza sativa subsp. indica GN=RPL10A PE=3 SV=1 133 234 6.0E-06
sp|P59231|R10A3_ARATH 60S ribosomal protein L10a-3 OS=Arabidopsis thaliana GN=RPL10AC PE=1 SV=1 133 232 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|679400
MAKDDLIDDRVSTSQIQKAVDALHAYESKKQEEREETELLSGKEPIIWLNVAVKQVAPKNVIKPHKIPIAHPIVD
PRTTSICLITKDPQREYKDLLEEHNIKFISRVVGIAKLKGKYKAFEARRLLLKENGLFLADERVIPLLPKLLGAK
WFEAKKQPIPVCMTRKDLKGELERAISSTYMHLNNGTCTSIKIGTLSHKPSQVVSNIAKAIPAIAARIPAQWDNI
QSLFIKTNTSVSLPIWSCNLDERWGGLKKEEETTKKNVKSGKGKKRPVVEEGADDDDDNDDNDDGDDDDVAKVSG
QPRKKQKTNATGKITTPSSTSKPKKSPQPTDPQPLKSKKSAKSTSADLEKQQSQPQQRLQPKNKTQKSESRDQEQ
LKPEPDTKPKPRTSAASKNDMKQKRTAVGGSLEKKKEKILNKKIGSGVNGKDAKAKVLGKKVAFLT*
Coding >Agabi119p4|679400
ATGGCCAAGGATGACTTGATCGATGACAGGGTCTCTACTTCGCAGATACAAAAAGCAGTCGACGCACTGCACGCC
TACGAATCCAAAAAACAAGAAGAACGGGAAGAGACCGAACTTCTCTCCGGAAAGGAGCCCATAATATGGTTGAAC
GTCGCAGTCAAGCAAGTCGCTCCTAAGAACGTAATCAAGCCCCATAAAATTCCTATTGCTCACCCGATCGTCGAC
CCCCGAACAACATCCATCTGCCTCATAACAAAAGACCCTCAAAGGGAATACAAAGACCTTCTTGAAGAACATAAT
ATAAAATTTATCTCCCGTGTCGTTGGTATCGCCAAACTCAAGGGCAAATACAAAGCTTTCGAAGCTCGTCGATTG
CTGCTCAAGGAAAACGGCCTCTTCCTCGCAGATGAAAGGGTGATACCGCTCCTTCCCAAACTCCTCGGCGCCAAA
TGGTTCGAGGCTAAAAAGCAACCAATACCTGTGTGCATGACGCGGAAAGATCTAAAAGGCGAGTTGGAACGAGCC
ATCAGTTCAACATACATGCACCTAAACAACGGAACTTGCACTTCAATCAAGATTGGCACTCTCTCACACAAACCT
TCTCAAGTAGTTTCAAATATAGCGAAAGCTATCCCCGCCATTGCCGCTCGTATTCCAGCACAATGGGATAACATC
CAAAGTCTCTTTATCAAAACCAATACAAGTGTTAGTTTACCGATTTGGAGTTGCAATCTGGATGAACGGTGGGGT
GGGTTGAAGAAAGAAGAGGAAACAACGAAGAAAAATGTGAAGAGTGGTAAGGGAAAGAAAAGGCCTGTTGTTGAG
GAGGGTGCCGATGATGACGATGATAATGATGATAATGACGATGGAGATGATGACGATGTTGCGAAGGTTTCGGGA
CAGCCAAGAAAGAAACAGAAAACCAACGCCACCGGTAAAATTACCACACCGTCATCAACCTCCAAGCCCAAAAAA
TCGCCCCAACCAACAGATCCACAACCGCTCAAATCCAAAAAATCCGCTAAATCAACCTCCGCTGATCTCGAAAAA
CAACAATCACAGCCCCAACAACGTCTTCAACCCAAAAACAAAACACAAAAATCGGAATCTCGGGATCAAGAACAA
CTTAAACCCGAACCAGACACAAAACCCAAACCGAGAACTTCGGCAGCTTCAAAAAACGATATGAAACAGAAACGT
ACTGCTGTTGGGGGATCTTTGGAAAAGAAGAAGGAAAAGATTTTGAATAAGAAGATTGGGTCGGGTGTTAATGGG
AAGGATGCCAAGGCGAAGGTGTTGGGCAAGAAAGTCGCTTTCTTGACTTGA
Transcript >Agabi119p4|679400
ATGGCCAAGGATGACTTGATCGATGACAGGGTCTCTACTTCGCAGATACAAAAAGCAGTCGACGCACTGCACGCC
TACGAATCCAAAAAACAAGAAGAACGGGAAGAGACCGAACTTCTCTCCGGAAAGGAGCCCATAATATGGTTGAAC
GTCGCAGTCAAGCAAGTCGCTCCTAAGAACGTAATCAAGCCCCATAAAATTCCTATTGCTCACCCGATCGTCGAC
CCCCGAACAACATCCATCTGCCTCATAACAAAAGACCCTCAAAGGGAATACAAAGACCTTCTTGAAGAACATAAT
ATAAAATTTATCTCCCGTGTCGTTGGTATCGCCAAACTCAAGGGCAAATACAAAGCTTTCGAAGCTCGTCGATTG
CTGCTCAAGGAAAACGGCCTCTTCCTCGCAGATGAAAGGGTGATACCGCTCCTTCCCAAACTCCTCGGCGCCAAA
TGGTTCGAGGCTAAAAAGCAACCAATACCTGTGTGCATGACGCGGAAAGATCTAAAAGGCGAGTTGGAACGAGCC
ATCAGTTCAACATACATGCACCTAAACAACGGAACTTGCACTTCAATCAAGATTGGCACTCTCTCACACAAACCT
TCTCAAGTAGTTTCAAATATAGCGAAAGCTATCCCCGCCATTGCCGCTCGTATTCCAGCACAATGGGATAACATC
CAAAGTCTCTTTATCAAAACCAATACAAGTGTTAGTTTACCGATTTGGAGTTGCAATCTGGATGAACGGTGGGGT
GGGTTGAAGAAAGAAGAGGAAACAACGAAGAAAAATGTGAAGAGTGGTAAGGGAAAGAAAAGGCCTGTTGTTGAG
GAGGGTGCCGATGATGACGATGATAATGATGATAATGACGATGGAGATGATGACGATGTTGCGAAGGTTTCGGGA
CAGCCAAGAAAGAAACAGAAAACCAACGCCACCGGTAAAATTACCACACCGTCATCAACCTCCAAGCCCAAAAAA
TCGCCCCAACCAACAGATCCACAACCGCTCAAATCCAAAAAATCCGCTAAATCAACCTCCGCTGATCTCGAAAAA
CAACAATCACAGCCCCAACAACGTCTTCAACCCAAAAACAAAACACAAAAATCGGAATCTCGGGATCAAGAACAA
CTTAAACCCGAACCAGACACAAAACCCAAACCGAGAACTTCGGCAGCTTCAAAAAACGATATGAAACAGAAACGT
ACTGCTGTTGGGGGATCTTTGGAAAAGAAGAAGGAAAAGATTTTGAATAAGAAGATTGGGTCGGGTGTTAATGGG
AAGGATGCCAAGGCGAAGGTGTTGGGCAAGAAAGTCGCTTTCTTGACTTGA
Gene >Agabi119p4|679400
ATGGCCAAGGATGACTTGATCGATGACAGGGTCTCTACTTCGCAGATACAAAAAGCAGTCGACGCACTGCACGCC
TACGAATCCAAAAAACAAGAAGAACGGGAAGAGACCGAACTTCTCTCCGGAAAGGAGCCCATAATATGGTTGAAC
GTCGCAGTCAAGCAAGTCGCTCCTAAGAACGTAATCAAGCCCCATAAAATGTACCCAGGACCCATATCCACCTCG
AACGAGCCAGAAAAAACTGACTTTACTCTTTCTTTAGTCCTATTGCTCACCCGATCGTCGACCCCCGAACAACAT
CCATCTGCCTCATAACAAAAGACCCTCAAAGGGAATACAAAGACCTTCTTGAAGAACATAATATAAAATTTATCT
CCCGTGTCGTTGGTATCGCCAAACTCAAGGGCAAATACAAAGCTTTCGAAGCTCGTCGATTGCTGCTCAAGGAAA
ACGGCCTCTTCCTCGCAGATGAAAGGGTGATACCGCTCCTTCCCAAACTCCTCGGCGCCAAATGGTTCGAGGCTA
AAAAGTGCGTATACATACAGAGTCATATCTCCCACCTCATGTATTGACAAACATCTCCTAATCCCCACGTCTATA
TTCAATCCTGTCCATGTACACCCTTACTCGCCTTTAAACCCTGAACTCATTTCAACTACTCGATCAAAATCTCTC
AATTTCAAATCTGGGTTGACAATTAATCAAAGGCAACCAATACCTGTGTGCATGACGCGGAAAGATCTAAAAGGC
GAGTTGGAACGAGCCATCAGTTCAACATACATGCACCTAAACAACGGAACTTGCACGTACGTCTCTCCTCTTACG
CCCCAACTCTTCCACCCTTCTGAACCACTCTTCCATTACTACCAAAACCCTGAATATGCACCGCAATGTTGACAC
GATCCAAAAATATATCGCAAACTTAAATGAACATCTTCAATGGTCGGGGTCTACTACTTTCCGATTCTATGAACC
CTTACTACACGATCTCTATCAACAAATGACTCCTACATACATCGGACCAATCAATAGTTCAATCAAGATTGGCAC
TCTCTCACACAAACCTTCTCAAGTAGTTTCAAATATAGCGAAAGCTATCCCCGCCATTGCCGCTCGTATTCCAGC
ACAATGGGATAACATCCAAAGTCTCTTTATCAAAACCAATACAAGTGTTAGTTTACCGATTTGGAGTTGCAATCT
GGATGAACGGTGGGGTGGGTTGAAGAAAGAAGAGGAAACAACGAAGAAAAATGTGAAGAGTGGTAAGGGAAAGAA
AAGGCCTGTTGTTGAGGAGGGTGCCGATGATGACGATGATAATGATGATAATGACGATGGAGATGATGACGATGT
TGCGAAGGTTTCGGGACAGCCAAGAAAGAAACAGAAAACCAACGCCACCGGTAAAATTACCACACCGTCATCAAC
CTCCAAGCCCAAAAAATCGCCCCAACCAACAGATCCACAACCGCTCAAATCCAAAAAATCCGCTAAATCAACCTC
CGCTGATCTCGAAAAACAACAATCACAGCCCCAACAACGTCTTCAACCCAAAAACAAAACACAAAAATCGGAATC
TCGGGATCAAGAACAACTTAAACCCGAACCAGACACAAAACCCAAACCGAGAACTTCGGCAGCTTCAAAAAACGA
TATGAAACAGAAACGTACTGCTGTTGGGGGATCTTTGGAAAAGAAGAAGGAAAAGATTTTGAATAAGAAGATTGG
GTCGGGTGTTAATGGGAAGGATGCCAAGGCGAAGGTGTTGGGCAAGAAAGTCGCTTTCTTGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail