Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|678850
Gene name
Locationscaffold_07:648690..650049
Strand+
Gene length (bp)1359
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup680
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|099500
Agaricus bisporus var bisporus H97 AgabiH97|099500
Agaricus bisporus var burnettii H119p4 Agabi119p4|099500
Agaricus bisporus var burnettii H119p4 Agabi119p4|678850 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|678850
MTRQFWYNRIHRLCKEYAVFPPEEELEEYTIAELEQWTLRRYHARNTSPVKLQLHSRNSPMLGFYGDVFLVPGGR
WLLIRYGGLSVYFTDLDSSNLDYHLLLDPSNDNARINRCILLGYCIWINHKAPRLSFLFEATAIDGGSDLEFARV
YIYQVDLMGHGPGATLVAQIIATFQTPRKNIWRFKHALNNRYFIRNHGWDSCAVPGVEVVEYSQAMGCLDYPLMV
SHTLLNEVYANHLEFINEDVLAVYCEVTCSYQIFNIESSTSSKLLHKIKIDSDSHNFSRIRWTPNASLITFIEGQ
HHETKTLHALVMPHDSRFHPWTVEIGNLRLVGQNYENIQQSLGIFTSRLWNKTDKSSHFGHKWDYTCELSTCSRP
ADISILEQDVDQLGILIAFDEDIGRSLHSDGRELNVVDVRAG*
Coding >Agabi119p4|678850
ATGACACGGCAATTCTGGTATAATCGTATTCATCGACTCTGCAAAGAATATGCCGTCTTTCCACCTGAAGAAGAA
TTGGAAGAATATACCATAGCTGAACTCGAGCAATGGACCTTGCGACGATATCATGCTAGGAATACTTCCCCTGTG
AAGTTACAACTTCACAGCCGAAATTCTCCCATGCTGGGGTTTTATGGAGATGTGTTTCTCGTTCCAGGCGGTCGA
TGGCTTTTAATTCGTTACGGCGGATTGAGCGTATACTTCACCGACTTGGACAGCAGCAATCTAGACTACCACCTC
CTGTTAGACCCCAGCAATGATAATGCCCGCATCAACCGTTGTATACTTCTTGGATATTGTATATGGATCAATCAT
AAAGCGCCACGATTGTCTTTTCTCTTTGAAGCCACCGCTATTGACGGAGGGAGTGATTTGGAGTTTGCCCGAGTG
TATATCTATCAAGTCGATCTGATGGGTCATGGTCCCGGTGCAACTCTCGTAGCTCAGATTATTGCTACCTTTCAA
ACCCCCCGGAAAAACATATGGCGTTTCAAACATGCTCTCAATAATCGTTATTTTATTCGAAACCATGGATGGGAC
TCGTGTGCGGTTCCGGGAGTGGAGGTCGTCGAATATAGCCAAGCCATGGGATGCCTGGATTATCCCTTGATGGTC
AGCCATACCCTTCTCAATGAAGTTTATGCTAATCACTTGGAGTTCATCAACGAGGACGTTCTTGCCGTCTATTGC
GAAGTAACATGTTCCTATCAAATATTCAACATAGAGTCATCGACTTCGTCCAAACTTTTGCATAAAATAAAAATA
GATTCGGATTCGCATAATTTTTCTAGGATTCGTTGGACACCGAATGCGTCACTAATCACTTTCATCGAGGGGCAG
CATCACGAAACGAAAACACTTCATGCACTCGTTATGCCTCATGACAGCAGGTTTCACCCATGGACAGTCGAGATA
GGCAATCTCAGGCTCGTAGGACAAAACTACGAAAACATCCAACAAAGTCTTGGTATCTTCACCTCGCGCTTATGG
AATAAGACGGATAAATCCTCCCACTTCGGTCATAAATGGGACTACACATGCGAGTTGTCAACTTGTAGTCGACCA
GCCGATATATCAATTCTGGAGCAGGATGTGGATCAGCTGGGGATACTCATTGCGTTTGATGAAGATATCGGACGC
TCCCTTCATTCTGACGGTCGTGAACTGAACGTAGTCGATGTTAGAGCAGGTTGA
Transcript >Agabi119p4|678850
ATGACACGGCAATTCTGGTATAATCGTATTCATCGACTCTGCAAAGAATATGCCGTCTTTCCACCTGAAGAAGAA
TTGGAAGAATATACCATAGCTGAACTCGAGCAATGGACCTTGCGACGATATCATGCTAGGAATACTTCCCCTGTG
AAGTTACAACTTCACAGCCGAAATTCTCCCATGCTGGGGTTTTATGGAGATGTGTTTCTCGTTCCAGGCGGTCGA
TGGCTTTTAATTCGTTACGGCGGATTGAGCGTATACTTCACCGACTTGGACAGCAGCAATCTAGACTACCACCTC
CTGTTAGACCCCAGCAATGATAATGCCCGCATCAACCGTTGTATACTTCTTGGATATTGTATATGGATCAATCAT
AAAGCGCCACGATTGTCTTTTCTCTTTGAAGCCACCGCTATTGACGGAGGGAGTGATTTGGAGTTTGCCCGAGTG
TATATCTATCAAGTCGATCTGATGGGTCATGGTCCCGGTGCAACTCTCGTAGCTCAGATTATTGCTACCTTTCAA
ACCCCCCGGAAAAACATATGGCGTTTCAAACATGCTCTCAATAATCGTTATTTTATTCGAAACCATGGATGGGAC
TCGTGTGCGGTTCCGGGAGTGGAGGTCGTCGAATATAGCCAAGCCATGGGATGCCTGGATTATCCCTTGATGGTC
AGCCATACCCTTCTCAATGAAGTTTATGCTAATCACTTGGAGTTCATCAACGAGGACGTTCTTGCCGTCTATTGC
GAAGTAACATGTTCCTATCAAATATTCAACATAGAGTCATCGACTTCGTCCAAACTTTTGCATAAAATAAAAATA
GATTCGGATTCGCATAATTTTTCTAGGATTCGTTGGACACCGAATGCGTCACTAATCACTTTCATCGAGGGGCAG
CATCACGAAACGAAAACACTTCATGCACTCGTTATGCCTCATGACAGCAGGTTTCACCCATGGACAGTCGAGATA
GGCAATCTCAGGCTCGTAGGACAAAACTACGAAAACATCCAACAAAGTCTTGGTATCTTCACCTCGCGCTTATGG
AATAAGACGGATAAATCCTCCCACTTCGGTCATAAATGGGACTACACATGCGAGTTGTCAACTTGTAGTCGACCA
GCCGATATATCAATTCTGGAGCAGGATGTGGATCAGCTGGGGATACTCATTGCGTTTGATGAAGATATCGGACGC
TCCCTTCATTCTGACGGTCGTGAACTGAACGTAGTCGATGTTAGAGCAGGTTGA
Gene >Agabi119p4|678850
ATGACACGGCAATTCTGGTATAATCGTATTCATCGACTCTGCAAAGAATATGCCGTCTTTCCACCTGAAGAAGAA
TTGGAAGAATATACCATAGCTGAACTCGAGCAATGGACCTTGCGACGATATCATGCTAGGAATACTTCCCCTGTG
AAGTTACAACTTCACAGCCGAAATTCTCCCATGCTGGGGTTTTATGGAGATGTGTTTCTCGTTCCAGGCGGTCGA
TGGCTTTTAATTCGTTACGGCGGATTGAGCGTATACTTCACCGACTTGGACAGCAGCAATCTAGACTACCACCTC
CTGTTAGACCCCAGCAATGATAATGCCCGCATCAACCGTTGTATACTTCTTGGATATTGTATATGGATCAATCAT
AAAGCGCCACGATTGTCTTTTCTCTTTGAAGCCACCGCTATTGACGGAGGTCCGTCTGCTTATTGTCATGTTTAA
TGTGGCTGATCGTCTCTCAGGGAGTGATTTGGAGTTTGCCCGAGTGTATATCTATCAAGTCGATCTGATGGGTCA
TGGTCCCGGTGCAACTCTCGTAGCTCAGATTATTGCTACCTTTCAAACCCCCCGGAAAAACATATGGCGTTTCAA
ACATGCTCTCAATAATCGTTATTTTATTCGAAACCATGGATGGGACTCGTGTGCGGTTCCGGGAGTGGAGGTCGT
CGAATATAGCCAAGCCATGGGATGCCTGGATTATCCCTTGATGGTCAGCCATACCCTTCTCAATGAAGTTTATGC
TAATGTTTGTGCATTCTCTATTCATAGCTTGTAATGTTACTCATTTTGAAGTATCATGGATAGCACTTGGAGTTC
ATCAACGAGGACGTTCTTGCCGTCTATTGCGAAGTAACATGTTCCTATCAAATATTCAACATAGAGTCATCGACT
TCGTCCAAACTTTTGCATAAAATAAAAATAGATTCGGATTCGCATAATTTTTCTAGGATTCGTTGGACACCGAAT
GCGTCACTAATCACTTTCATCGAGGGGCAGCATCACGAAACGAAAACACTTCATGCACTCGTTATGCCTCATGAC
AGCAGGTTTCACCCATGGACAGTCGAGATAGGCAATCTCAGGCTCGTAGGACAAAACTACGAAAACATCCAACAA
AGTCTTGGTATCTTCACCTCGCGCTTATGGAATAAGACGGATAAATCCTCCCACTTCGGTCATAAATGGGACTAC
ACATGCGAGTTGTCAACTTGTAGTCGACCAGCCGATATATCAATTCTGGAGCAGGATGTGGATCAGCTGGGGATA
CTCATTGCGTTTGATGAAGATATCGGACGCTCCCTTCATTCTGACGGTCGTGAACTGAACGTAGTCGATGTTAGA
GCAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail