Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|670400
Gene name
Locationscaffold_06:2160930..2166212
Strand-
Gene length (bp)5282
Transcript length (bp)5214
Coding sequence length (bp)5214
Protein length (aa) 1738

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 4.2E-30 1062 1163
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 7.9E-24 1030 1133
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 7.9E-22 803 964
PF17921 Integrase_H2C2 Integrase zinc binding domain 5.9E-15 1296 1351
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 4.1E-06 1674 1721

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 726 1654 8.0E-113
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 726 1654 8.0E-113
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 726 1654 8.0E-113
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 726 1654 8.0E-113
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 726 1654 9.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 726 1654 8.0E-113
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 726 1654 8.0E-113
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 726 1654 8.0E-113
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 726 1654 8.0E-113
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 726 1654 9.0E-113
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 726 1654 9.0E-113
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 726 1654 9.0E-113
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 726 1654 9.0E-113
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 726 1654 7.0E-112
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 726 1654 7.0E-112
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 726 1654 9.0E-112
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 747 1639 3.0E-98
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 747 1639 5.0E-98
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 695 1488 8.0E-81
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 765 1483 1.0E-78
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 717 1648 1.0E-77
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 779 1483 1.0E-77
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 783 1483 1.0E-62
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 727 1190 2.0E-50
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 747 1183 2.0E-50
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 747 1183 5.0E-50
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 747 1183 8.0E-49
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 747 1183 9.0E-49
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 747 1183 9.0E-49
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 747 1183 6.0E-48
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 781 1183 1.0E-40
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 765 1183 2.0E-34
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 777 1183 3.0E-34
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 777 1183 4.0E-34
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 750 1079 7.0E-33
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 682 1194 6.0E-30
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 741 1168 2.0E-27
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 759 1184 5.0E-27
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 763 1161 1.0E-25
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 763 1161 2.0E-25
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 749 1183 7.0E-25
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 759 1161 4.0E-24
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 751 1137 1.0E-23
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 751 1146 4.0E-23
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 759 1183 3.0E-22
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 727 1137 2.0E-21
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 696 1197 2.0E-21
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 722 1137 3.0E-21
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 722 1137 3.0E-21
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 722 1137 3.0E-21
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 722 1137 5.0E-21
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 1286 1633 7.0E-21
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 727 1137 2.0E-20
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 751 1157 2.0E-20
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 722 1137 2.0E-20
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 722 1137 3.0E-20
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 722 1137 2.0E-19
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 1290 1633 4.0E-19
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 1288 1522 9.0E-19
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 1290 1633 1.0E-17
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 1252 1494 2.0E-16
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 701 1007 3.0E-15
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 812 934 5.0E-15
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 1298 1522 1.0E-14
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 773 1057 2.0E-14
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 773 1005 5.0E-14
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal a-particle MIA14 GN=pol PE=3 SV=1 773 969 9.0E-14
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 1374 1620 1.0E-13
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 834 1175 2.0E-13
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 773 1061 5.0E-13
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 773 1005 1.0E-12
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 1281 1620 2.0E-12
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 1374 1620 2.0E-12
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 1374 1620 2.0E-12
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 1342 1620 2.0E-12
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 1342 1620 3.0E-12
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 765 1016 3.0E-12
sp|P03354|POL_RSVP Gag-Pro-Pol polyprotein OS=Rous sarcoma virus (strain Prague C) GN=gag-pro-pol PE=1 SV=2 765 1044 3.0E-12
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 898 1178 3.0E-12
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 773 1008 4.0E-12
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 773 1061 4.0E-12
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 773 1008 6.0E-12
sp|Q04095|POL_RSVSA Gag-Pro-Pol polyprotein OS=Avian leukosis virus RSA GN=gag-pro-pol PE=3 SV=2 765 1044 7.0E-12
sp|O92956|POL_RSVSB Gag-Pro-Pol polyprotein OS=Rous sarcoma virus (strain Schmidt-Ruppin B) GN=gag-pro-pol PE=1 SV=2 765 1087 7.0E-12
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 765 1016 7.0E-12
sp|Q7SQ98|POL_ALV Pol polyprotein OS=Avian leukosis virus GN=pol PE=3 SV=1 765 1044 8.0E-12
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 765 1001 8.0E-12
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 1281 1620 1.0E-11
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 765 1001 1.0E-11
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 765 1001 1.0E-11
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 765 1001 1.0E-11
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 744 1001 1.0E-11
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 773 1008 1.0E-11
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 1374 1620 2.0E-11
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 1281 1620 3.0E-11
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 933 1067 3.0E-11
sp|P25059|POL_BLVAU Pol polyprotein OS=Bovine leukemia virus (isolate Australian) GN=pol PE=3 SV=1 773 1010 3.0E-11
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 765 918 5.0E-11
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 1374 1620 6.0E-11
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 1374 1620 6.0E-11
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 765 1001 7.0E-11
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 834 1168 7.0E-11
sp|P03361|POL_BLVJ Pol polyprotein OS=Bovine leukemia virus (isolate Japanese BLV-1) GN=pol PE=3 SV=1 773 1010 8.0E-11
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 1325 1620 1.0E-10
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 773 1008 4.0E-10
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 1374 1620 1.0E-09
sp|P63128|POK9_HUMAN Endogenous retrovirus group K member 9 Pol protein OS=Homo sapiens GN=ERVK-9 PE=3 SV=3 765 903 2.0E-09
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 774 1068 2.0E-09
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 778 963 3.0E-09
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 745 1005 6.0E-09
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 1286 1620 2.0E-08
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 720 1032 3.0E-08
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 1309 1620 1.0E-07
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 1306 1503 1.0E-07
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 1374 1620 2.0E-07
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 745 1068 3.0E-07
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 1286 1507 3.0E-07
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 1286 1503 4.0E-07
sp|P23427|POL_VILV2 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS2) GN=pol PE=3 SV=1 773 943 6.0E-07
sp|P03370|POL_VILV Pol polyprotein OS=Maedi visna virus (strain 1514) GN=pol PE=3 SV=1 773 943 6.0E-07
sp|P35956|POL_VILVK Pol polyprotein OS=Maedi visna virus (strain KV1772) GN=pol PE=1 SV=1 773 943 6.0E-07
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 1093 1183 1.0E-06
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 761 943 1.0E-06
sp|P23426|POL_VILV1 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS1) GN=pol PE=3 SV=1 750 943 2.0E-06
sp|Q89928|POL_HV2EH Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) GN=gag-pol PE=3 SV=3 751 1062 2.0E-06
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 757 1030 2.0E-06
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 773 943 2.0E-06
sp|P03371|POL_EIAVY Pol polyprotein OS=Equine infectious anemia virus (strain Wyoming) GN=pol PE=3 SV=1 713 1008 3.0E-06
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 761 943 3.0E-06
sp|Q76634|POL_HV2UC Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate UC1) GN=gag-pol PE=3 SV=3 751 1062 3.0E-06
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 780 1074 3.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 763 943 4.0E-06
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 751 943 4.0E-06
sp|P05896|POL_SIVM1 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate Mm142-83) GN=gag-pol PE=1 SV=2 780 1074 5.0E-06
sp|P11292|DPOL_WHV6 Protein P (Fragment) OS=Woodchuck hepatitis B virus (isolate w64/pWS23) GN=P PE=2 SV=1 883 1027 6.0E-06
sp|P12898|DPOL_WHV4 Protein P OS=Woodchuck hepatitis B virus (isolate 7) GN=P PE=3 SV=1 883 1027 6.0E-06
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 755 1030 7.0E-06
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 751 943 7.0E-06
sp|P17396|DPOL_WHV5 Protein P OS=Woodchuck hepatitis B virus (isolate 8) GN=P PE=3 SV=1 883 1015 7.0E-06
sp|P12502|POL_SIVS4 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate F236/smH4) GN=gag-pol PE=3 SV=2 780 1074 9.0E-06
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 779 1008 1.0E-05
sp|P05962|POL_HV2NZ Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 773 943 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|670400
MHTAYTVASQRPSKPKGPGPLSGPNSLLPTLEVIPTSSPASSSRDHTDTALLRSRKLVPKSTVPIHNDHSQVPQS
VVEPQLNVHEVIDHEDLDSSDDQLLLASLPQSPAPTTSQQLTLSANLPLTTASSPDTESDSESDSDSSSDFDMGK
SPITISAGIELSKVGGLPRVTATTLTPSILRDLEDYANVCYQVGRKVAPAKQLKKLAACFSNIEHMSWVLTEADL
QPEGTTLSAFLDKMRKRFLPNNWELLIEAKREAEIMHEDDTYMDWATRIKKKNNILKGTPCHLNDKCLRLFLLSH
LEHGLKGIVFSATDDKGTKVTDIKEFSHWEQEVQRLDTLRASQRASQRQLVLSMMNDNDRHRDSKPGKSKGKKQS
DGKISSDRCPPLTGDERTILYKYDGCLKCRKVFQDHISKDCTAAWPKKDGYRAVQEPPQSDIDAWKKKPSGSRDK
RSRSDHASHASSSHPSKRAKKDVAAAILESESDSSEADDVIAAIEDDGDTTDEVRGRHLYWDCSLTGPNSESPVN
TTALLDSGAHVVLIRDTLVSELGLKRFPLSDTFSVRGAMSTHRSFINEYVYIVLSSCDMSYTARPVRALIIGELS
APIILGMPFLSRNAIQINHHTRVVTDTLQNVNLLGSGSTTHTKPIKRDTDAHPNPKHKKRNTQLTTAPYRKLLVE
SLKDKLRTTKMTLSPHQHTSSSDAHEVVAAIHKRITQVIDEEVLRRLHAKIVSEFASVFSAMPKVSCLPKDIEAD
IRLKDPQLTVKPRTYSCPRRYKEAWKKLIDDHLEAGRIQPSASPFASPSFCIPKSDPSAPPRWVNDYRELNKNTV
PDNYALPKVDDVLNDCAKGKYFAVIDMTNAFFQTRMRAKDIHKTAVTTPFGSFEWKVMPMGLRNAPAIHQRRINK
ALRAHIGKICQAYIDDIVIWSHTLSEHETNVRLILSTLQQAGLYCNLKKTKLFCTEINFLGHHISSDGIRADDRK
AEKIVNWPIPQNAKDVRQFLGLVRYVAVFLPDLARYSTILNKLTDKSSVTDFPDWNDSHQHAFDKIKELVLSRDC
LTTIDYTAMPLKRVFVSTDASDFASGAVLSFGETFETAQPVAFESKSFKGAELNYPVHEKELFAIVRALEKWRVD
LLGVPFTVLTDHRTLECFNTQRHLSRRQARWMEFLQQYDFSIVYLRGEDNVAADALSRTTFTNAISEQDAFHMSP
CDRLDELDISVCATLDNALTPQAEWAAMLSLLPNDTIAHTLDIAADDELRDSILAGYTNDTWCTKLLATWQQMHN
VVLRGGLLFFEDRLIIPRTGNVRETIFALAHDSLGHFGLDKSYEALRGSFYWPGMHTDLEKLYVPKCAQCQRMKS
STKKPIGPLHPLPIPDHRFQAVAIDFVGPLPEELGFNCIFTMTDRLGADVRLVPTTMNATAVDTAQLFFHHWYCE
NGLPQEIVSDRDKLFTSSFWRSLHELTGTALKMSTSFHPQTDGASERTNKTLNQCLRMHVDSMQRGWVKALPAIR
FAMMNTQNASTGLTGFQLRMGCSPRVIPPIYRDNSDLPTESPEDFLFRVSSLEAQARDTLLQHKVLQAHQANKHR
DTSPFPFVVGGRVKLSTANRRKKLSVEGAKRVAKLMPRFEGPYVIRAVNEENSTVTLEIPRRGHPNGTESFHTSL
VRQWVEDDAQVFDRPPLNDAGEAEVEEIVERRKIGRGWSYRVKYRGYPKEENQWLPGREVENLEALDRFFAREGL
TELGQTVSLSSG*
Coding >Agabi119p4|670400
ATGCATACAGCATACACCGTGGCGTCTCAACGTCCTTCGAAACCGAAAGGTCCAGGTCCTCTCTCTGGTCCAAAC
AGTCTTTTGCCTACGCTGGAGGTCATTCCGACTTCCTCCCCTGCGTCTTCTTCGCGAGACCATACCGACACTGCT
CTTTTACGTTCCAGAAAACTGGTTCCGAAATCTACTGTACCGATACACAACGACCACAGTCAAGTTCCACAGAGC
GTTGTTGAGCCTCAACTGAACGTACACGAAGTAATTGACCACGAAGACCTTGATTCCAGCGACGATCAACTTCTA
CTTGCATCTCTACCTCAGTCACCCGCACCGACTACATCACAACAGCTCACTCTGTCAGCGAACTTGCCGTTGACT
ACTGCTTCCTCTCCTGACACCGAATCCGACTCTGAATCCGACTCCGATTCATCTTCCGATTTTGACATGGGTAAA
TCACCTATCACCATCAGCGCCGGAATTGAACTGTCGAAAGTTGGTGGATTACCTCGGGTCACTGCTACCACTCTC
ACTCCGTCGATCCTCCGTGACCTCGAGGACTACGCGAACGTTTGTTACCAGGTTGGCAGGAAAGTCGCTCCAGCA
AAACAACTGAAGAAGTTGGCGGCTTGCTTCTCGAACATTGAACATATGTCATGGGTTTTAACGGAAGCTGATCTA
CAACCAGAGGGAACCACGTTGAGTGCTTTCTTGGACAAAATGCGTAAACGTTTCTTACCCAATAATTGGGAGCTC
CTCATCGAGGCCAAACGCGAGGCCGAAATCATGCATGAGGACGACACATACATGGATTGGGCTACTCGTATTAAG
AAGAAGAACAACATTCTTAAAGGAACCCCTTGCCATTTAAACGACAAATGCTTGCGCCTCTTCTTACTGTCCCAT
CTCGAGCATGGCCTGAAGGGCATTGTATTCTCGGCTACAGACGACAAAGGTACCAAAGTTACAGATATCAAAGAG
TTCAGCCACTGGGAACAGGAGGTCCAGCGCTTGGATACATTACGAGCTTCACAACGTGCATCTCAACGACAGCTT
GTCTTGAGCATGATGAACGACAACGACCGCCACCGTGATTCCAAACCAGGAAAGTCGAAAGGCAAGAAGCAGAGC
GACGGAAAAATCTCTTCTGACAGATGTCCTCCTCTTACTGGCGACGAACGTACCATCCTATACAAGTATGACGGC
TGTTTGAAATGTCGTAAGGTTTTCCAGGACCACATCTCGAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGG
TATCGTGCTGTACAAGAACCTCCCCAGTCGGATATTGACGCTTGGAAGAAGAAACCTTCCGGTAGTCGGGATAAA
CGATCACGCTCTGATCATGCCTCGCATGCGTCTTCTTCTCATCCTAGCAAACGTGCTAAAAAGGATGTTGCTGCT
GCGATATTGGAATCGGAGAGTGATAGTTCCGAAGCTGACGATGTGATTGCTGCAATTGAGGATGACGGCGATACT
ACCGACGAAGTGCGTGGCAGACACCTTTACTGGGATTGCTCACTAACGGGTCCTAACAGTGAATCTCCTGTTAAC
ACTACGGCATTACTGGACAGTGGGGCACATGTTGTCCTTATTCGCGACACCTTAGTTTCAGAGCTCGGACTCAAA
CGTTTTCCGCTTAGCGATACCTTCTCTGTTCGTGGTGCCATGTCTACCCATCGCTCGTTTATAAATGAATATGTT
TACATCGTTCTCTCCTCATGTGATATGTCCTACACTGCACGTCCTGTGAGAGCTCTTATAATTGGCGAATTGTCT
GCACCAATTATTCTGGGAATGCCTTTCCTGTCCCGAAATGCTATTCAAATTAATCATCACACAAGAGTCGTCACA
GATACATTGCAAAATGTCAATTTGCTCGGGTCTGGTAGCACTACGCATACCAAACCCATAAAACGAGACACTGAT
GCGCATCCGAACCCAAAACATAAGAAGCGCAATACTCAGCTTACCACTGCGCCTTACCGAAAATTACTTGTGGAG
AGTCTTAAAGATAAACTGCGTACCACGAAAATGACTCTGTCTCCACACCAACATACATCTTCTTCTGATGCGCAC
GAAGTGGTTGCTGCGATTCACAAGCGCATAACACAAGTCATTGATGAAGAAGTATTACGTCGGTTACATGCCAAA
ATTGTCTCCGAGTTTGCTTCTGTTTTTTCTGCCATGCCTAAAGTATCTTGTCTTCCTAAAGACATTGAAGCTGAC
ATTAGACTTAAAGATCCCCAGTTGACTGTTAAGCCACGTACCTATAGTTGCCCTCGTCGTTATAAGGAGGCTTGG
AAGAAACTTATTGATGACCACCTGGAGGCTGGTCGTATTCAACCGTCTGCTTCGCCTTTCGCGTCACCTTCTTTT
TGCATCCCAAAATCTGATCCTTCCGCTCCACCTCGTTGGGTAAACGATTATCGAGAATTGAACAAAAACACCGTC
CCTGACAATTATGCATTGCCTAAGGTTGACGATGTCTTGAATGACTGTGCTAAAGGAAAATATTTTGCTGTCATC
GACATGACAAATGCCTTTTTCCAAACTCGCATGCGAGCAAAAGACATTCACAAAACAGCTGTAACCACTCCGTTT
GGTTCTTTTGAATGGAAGGTCATGCCGATGGGTTTGCGCAACGCACCTGCGATCCACCAACGTCGTATTAACAAG
GCTTTACGTGCCCACATTGGGAAAATCTGTCAAGCTTATATCGACGACATTGTGATTTGGTCGCATACACTGTCT
GAACACGAAACTAATGTACGGTTGATTTTGTCAACATTACAACAAGCGGGTTTGTACTGCAACCTGAAGAAGACA
AAATTGTTCTGCACCGAAATAAATTTCCTTGGACACCACATCAGTTCTGACGGTATACGAGCAGACGACCGTAAG
GCTGAGAAAATTGTCAACTGGCCGATCCCACAGAATGCTAAGGATGTCCGTCAGTTCTTAGGCCTCGTTCGCTAC
GTGGCTGTCTTTTTACCAGACCTTGCTCGTTATTCGACGATTCTTAATAAGCTCACTGATAAATCATCTGTCACG
GACTTTCCTGACTGGAATGACTCGCATCAACATGCGTTCGACAAAATTAAAGAATTAGTGCTCTCACGCGACTGC
TTGACGACTATTGATTACACCGCAATGCCACTGAAGCGAGTTTTTGTCTCTACCGATGCTTCCGATTTTGCAAGC
GGTGCCGTCCTCTCTTTTGGCGAGACTTTTGAAACCGCGCAACCTGTGGCTTTTGAATCTAAGTCGTTCAAGGGT
GCTGAACTTAACTATCCGGTCCACGAGAAGGAGCTTTTTGCAATTGTTAGAGCACTCGAAAAATGGCGGGTCGAC
CTGCTTGGCGTACCTTTTACGGTCCTCACTGACCACCGGACACTCGAGTGTTTCAACACACAACGGCACTTATCC
CGTCGCCAAGCCCGGTGGATGGAGTTTCTACAACAATACGATTTCAGCATTGTTTATCTTCGAGGTGAAGACAAT
GTCGCCGCCGACGCGTTATCACGGACCACATTTACAAATGCAATTTCCGAGCAAGATGCTTTCCATATGTCCCCC
TGTGATCGTTTGGATGAACTGGACATTTCAGTGTGTGCGACATTGGACAATGCACTCACACCTCAAGCGGAATGG
GCTGCCATGCTGTCCCTCCTCCCTAACGACACTATTGCCCACACGCTTGATATCGCAGCTGATGATGAGCTTCGT
GACTCTATTCTTGCTGGCTACACAAACGATACATGGTGCACGAAACTACTGGCCACTTGGCAACAAATGCACAAT
GTGGTGTTGCGCGGTGGTTTGCTGTTTTTCGAAGATCGTCTCATCATCCCCCGTACCGGGAACGTACGGGAAACA
ATATTCGCCCTCGCTCATGATTCTTTGGGTCACTTCGGGCTCGATAAATCCTACGAGGCGCTACGTGGCTCGTTT
TACTGGCCTGGAATGCACACGGATCTGGAAAAATTGTACGTGCCTAAATGTGCACAATGTCAACGAATGAAATCT
TCCACGAAGAAACCTATCGGTCCTCTGCATCCCCTTCCCATACCTGACCATCGTTTCCAAGCGGTTGCTATCGAT
TTCGTTGGGCCATTGCCTGAGGAACTTGGATTCAATTGTATCTTCACGATGACCGACCGCCTTGGAGCCGATGTT
CGCCTTGTCCCGACCACCATGAACGCTACAGCTGTGGATACCGCTCAGCTCTTTTTCCACCACTGGTATTGCGAA
AATGGTTTACCTCAAGAAATTGTATCTGATCGAGACAAATTGTTCACATCCTCCTTTTGGCGTTCACTCCACGAA
TTAACTGGTACCGCTTTGAAAATGTCTACATCGTTCCATCCACAGACTGATGGTGCCAGCGAACGTACCAATAAA
ACTCTGAACCAGTGTCTGCGCATGCATGTTGACAGCATGCAGCGAGGATGGGTTAAAGCCTTACCAGCTATCCGG
TTCGCTATGATGAATACTCAGAACGCCTCAACTGGGCTCACGGGTTTCCAACTCCGTATGGGTTGCTCACCTCGA
GTAATTCCGCCTATCTACCGTGATAACTCTGATTTGCCCACCGAGTCTCCCGAAGATTTCCTGTTCAGAGTCTCT
TCGTTAGAAGCACAAGCTCGAGACACATTGTTACAGCATAAAGTCCTCCAGGCTCACCAAGCTAACAAACATCGC
GATACATCTCCTTTCCCATTCGTTGTGGGTGGGCGAGTGAAGTTGTCTACTGCAAATCGACGCAAAAAGCTCTCC
GTCGAAGGAGCGAAACGTGTTGCTAAGCTCATGCCTCGGTTTGAAGGACCCTATGTGATTAGAGCTGTAAACGAA
GAAAACAGTACTGTCACGTTGGAAATCCCGCGACGGGGTCATCCTAATGGTACGGAATCGTTTCATACATCCCTT
GTTCGTCAATGGGTGGAAGACGACGCGCAAGTTTTCGACCGACCACCTCTCAACGACGCCGGAGAAGCTGAGGTG
GAAGAAATAGTGGAGCGTCGAAAGATTGGTCGCGGTTGGAGTTACCGTGTGAAATACAGGGGTTACCCCAAAGAA
GAGAACCAATGGTTACCTGGCAGAGAAGTCGAGAATCTTGAAGCACTCGACCGCTTTTTCGCCCGTGAAGGTCTT
ACAGAACTGGGACAGACCGTTTCATTGTCATCTGGGTAG
Transcript >Agabi119p4|670400
ATGCATACAGCATACACCGTGGCGTCTCAACGTCCTTCGAAACCGAAAGGTCCAGGTCCTCTCTCTGGTCCAAAC
AGTCTTTTGCCTACGCTGGAGGTCATTCCGACTTCCTCCCCTGCGTCTTCTTCGCGAGACCATACCGACACTGCT
CTTTTACGTTCCAGAAAACTGGTTCCGAAATCTACTGTACCGATACACAACGACCACAGTCAAGTTCCACAGAGC
GTTGTTGAGCCTCAACTGAACGTACACGAAGTAATTGACCACGAAGACCTTGATTCCAGCGACGATCAACTTCTA
CTTGCATCTCTACCTCAGTCACCCGCACCGACTACATCACAACAGCTCACTCTGTCAGCGAACTTGCCGTTGACT
ACTGCTTCCTCTCCTGACACCGAATCCGACTCTGAATCCGACTCCGATTCATCTTCCGATTTTGACATGGGTAAA
TCACCTATCACCATCAGCGCCGGAATTGAACTGTCGAAAGTTGGTGGATTACCTCGGGTCACTGCTACCACTCTC
ACTCCGTCGATCCTCCGTGACCTCGAGGACTACGCGAACGTTTGTTACCAGGTTGGCAGGAAAGTCGCTCCAGCA
AAACAACTGAAGAAGTTGGCGGCTTGCTTCTCGAACATTGAACATATGTCATGGGTTTTAACGGAAGCTGATCTA
CAACCAGAGGGAACCACGTTGAGTGCTTTCTTGGACAAAATGCGTAAACGTTTCTTACCCAATAATTGGGAGCTC
CTCATCGAGGCCAAACGCGAGGCCGAAATCATGCATGAGGACGACACATACATGGATTGGGCTACTCGTATTAAG
AAGAAGAACAACATTCTTAAAGGAACCCCTTGCCATTTAAACGACAAATGCTTGCGCCTCTTCTTACTGTCCCAT
CTCGAGCATGGCCTGAAGGGCATTGTATTCTCGGCTACAGACGACAAAGGTACCAAAGTTACAGATATCAAAGAG
TTCAGCCACTGGGAACAGGAGGTCCAGCGCTTGGATACATTACGAGCTTCACAACGTGCATCTCAACGACAGCTT
GTCTTGAGCATGATGAACGACAACGACCGCCACCGTGATTCCAAACCAGGAAAGTCGAAAGGCAAGAAGCAGAGC
GACGGAAAAATCTCTTCTGACAGATGTCCTCCTCTTACTGGCGACGAACGTACCATCCTATACAAGTATGACGGC
TGTTTGAAATGTCGTAAGGTTTTCCAGGACCACATCTCGAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGG
TATCGTGCTGTACAAGAACCTCCCCAGTCGGATATTGACGCTTGGAAGAAGAAACCTTCCGGTAGTCGGGATAAA
CGATCACGCTCTGATCATGCCTCGCATGCGTCTTCTTCTCATCCTAGCAAACGTGCTAAAAAGGATGTTGCTGCT
GCGATATTGGAATCGGAGAGTGATAGTTCCGAAGCTGACGATGTGATTGCTGCAATTGAGGATGACGGCGATACT
ACCGACGAAGTGCGTGGCAGACACCTTTACTGGGATTGCTCACTAACGGGTCCTAACAGTGAATCTCCTGTTAAC
ACTACGGCATTACTGGACAGTGGGGCACATGTTGTCCTTATTCGCGACACCTTAGTTTCAGAGCTCGGACTCAAA
CGTTTTCCGCTTAGCGATACCTTCTCTGTTCGTGGTGCCATGTCTACCCATCGCTCGTTTATAAATGAATATGTT
TACATCGTTCTCTCCTCATGTGATATGTCCTACACTGCACGTCCTGTGAGAGCTCTTATAATTGGCGAATTGTCT
GCACCAATTATTCTGGGAATGCCTTTCCTGTCCCGAAATGCTATTCAAATTAATCATCACACAAGAGTCGTCACA
GATACATTGCAAAATGTCAATTTGCTCGGGTCTGGTAGCACTACGCATACCAAACCCATAAAACGAGACACTGAT
GCGCATCCGAACCCAAAACATAAGAAGCGCAATACTCAGCTTACCACTGCGCCTTACCGAAAATTACTTGTGGAG
AGTCTTAAAGATAAACTGCGTACCACGAAAATGACTCTGTCTCCACACCAACATACATCTTCTTCTGATGCGCAC
GAAGTGGTTGCTGCGATTCACAAGCGCATAACACAAGTCATTGATGAAGAAGTATTACGTCGGTTACATGCCAAA
ATTGTCTCCGAGTTTGCTTCTGTTTTTTCTGCCATGCCTAAAGTATCTTGTCTTCCTAAAGACATTGAAGCTGAC
ATTAGACTTAAAGATCCCCAGTTGACTGTTAAGCCACGTACCTATAGTTGCCCTCGTCGTTATAAGGAGGCTTGG
AAGAAACTTATTGATGACCACCTGGAGGCTGGTCGTATTCAACCGTCTGCTTCGCCTTTCGCGTCACCTTCTTTT
TGCATCCCAAAATCTGATCCTTCCGCTCCACCTCGTTGGGTAAACGATTATCGAGAATTGAACAAAAACACCGTC
CCTGACAATTATGCATTGCCTAAGGTTGACGATGTCTTGAATGACTGTGCTAAAGGAAAATATTTTGCTGTCATC
GACATGACAAATGCCTTTTTCCAAACTCGCATGCGAGCAAAAGACATTCACAAAACAGCTGTAACCACTCCGTTT
GGTTCTTTTGAATGGAAGGTCATGCCGATGGGTTTGCGCAACGCACCTGCGATCCACCAACGTCGTATTAACAAG
GCTTTACGTGCCCACATTGGGAAAATCTGTCAAGCTTATATCGACGACATTGTGATTTGGTCGCATACACTGTCT
GAACACGAAACTAATGTACGGTTGATTTTGTCAACATTACAACAAGCGGGTTTGTACTGCAACCTGAAGAAGACA
AAATTGTTCTGCACCGAAATAAATTTCCTTGGACACCACATCAGTTCTGACGGTATACGAGCAGACGACCGTAAG
GCTGAGAAAATTGTCAACTGGCCGATCCCACAGAATGCTAAGGATGTCCGTCAGTTCTTAGGCCTCGTTCGCTAC
GTGGCTGTCTTTTTACCAGACCTTGCTCGTTATTCGACGATTCTTAATAAGCTCACTGATAAATCATCTGTCACG
GACTTTCCTGACTGGAATGACTCGCATCAACATGCGTTCGACAAAATTAAAGAATTAGTGCTCTCACGCGACTGC
TTGACGACTATTGATTACACCGCAATGCCACTGAAGCGAGTTTTTGTCTCTACCGATGCTTCCGATTTTGCAAGC
GGTGCCGTCCTCTCTTTTGGCGAGACTTTTGAAACCGCGCAACCTGTGGCTTTTGAATCTAAGTCGTTCAAGGGT
GCTGAACTTAACTATCCGGTCCACGAGAAGGAGCTTTTTGCAATTGTTAGAGCACTCGAAAAATGGCGGGTCGAC
CTGCTTGGCGTACCTTTTACGGTCCTCACTGACCACCGGACACTCGAGTGTTTCAACACACAACGGCACTTATCC
CGTCGCCAAGCCCGGTGGATGGAGTTTCTACAACAATACGATTTCAGCATTGTTTATCTTCGAGGTGAAGACAAT
GTCGCCGCCGACGCGTTATCACGGACCACATTTACAAATGCAATTTCCGAGCAAGATGCTTTCCATATGTCCCCC
TGTGATCGTTTGGATGAACTGGACATTTCAGTGTGTGCGACATTGGACAATGCACTCACACCTCAAGCGGAATGG
GCTGCCATGCTGTCCCTCCTCCCTAACGACACTATTGCCCACACGCTTGATATCGCAGCTGATGATGAGCTTCGT
GACTCTATTCTTGCTGGCTACACAAACGATACATGGTGCACGAAACTACTGGCCACTTGGCAACAAATGCACAAT
GTGGTGTTGCGCGGTGGTTTGCTGTTTTTCGAAGATCGTCTCATCATCCCCCGTACCGGGAACGTACGGGAAACA
ATATTCGCCCTCGCTCATGATTCTTTGGGTCACTTCGGGCTCGATAAATCCTACGAGGCGCTACGTGGCTCGTTT
TACTGGCCTGGAATGCACACGGATCTGGAAAAATTGTACGTGCCTAAATGTGCACAATGTCAACGAATGAAATCT
TCCACGAAGAAACCTATCGGTCCTCTGCATCCCCTTCCCATACCTGACCATCGTTTCCAAGCGGTTGCTATCGAT
TTCGTTGGGCCATTGCCTGAGGAACTTGGATTCAATTGTATCTTCACGATGACCGACCGCCTTGGAGCCGATGTT
CGCCTTGTCCCGACCACCATGAACGCTACAGCTGTGGATACCGCTCAGCTCTTTTTCCACCACTGGTATTGCGAA
AATGGTTTACCTCAAGAAATTGTATCTGATCGAGACAAATTGTTCACATCCTCCTTTTGGCGTTCACTCCACGAA
TTAACTGGTACCGCTTTGAAAATGTCTACATCGTTCCATCCACAGACTGATGGTGCCAGCGAACGTACCAATAAA
ACTCTGAACCAGTGTCTGCGCATGCATGTTGACAGCATGCAGCGAGGATGGGTTAAAGCCTTACCAGCTATCCGG
TTCGCTATGATGAATACTCAGAACGCCTCAACTGGGCTCACGGGTTTCCAACTCCGTATGGGTTGCTCACCTCGA
GTAATTCCGCCTATCTACCGTGATAACTCTGATTTGCCCACCGAGTCTCCCGAAGATTTCCTGTTCAGAGTCTCT
TCGTTAGAAGCACAAGCTCGAGACACATTGTTACAGCATAAAGTCCTCCAGGCTCACCAAGCTAACAAACATCGC
GATACATCTCCTTTCCCATTCGTTGTGGGTGGGCGAGTGAAGTTGTCTACTGCAAATCGACGCAAAAAGCTCTCC
GTCGAAGGAGCGAAACGTGTTGCTAAGCTCATGCCTCGGTTTGAAGGACCCTATGTGATTAGAGCTGTAAACGAA
GAAAACAGTACTGTCACGTTGGAAATCCCGCGACGGGGTCATCCTAATGGTACGGAATCGTTTCATACATCCCTT
GTTCGTCAATGGGTGGAAGACGACGCGCAAGTTTTCGACCGACCACCTCTCAACGACGCCGGAGAAGCTGAGGTG
GAAGAAATAGTGGAGCGTCGAAAGATTGGTCGCGGTTGGAGTTACCGTGTGAAATACAGGGGTTACCCCAAAGAA
GAGAACCAATGGTTACCTGGCAGAGAAGTCGAGAATCTTGAAGCACTCGACCGCTTTTTCGCCCGTGAAGGTCTT
ACAGAACTGGGACAGACCGTTTCATTGTCATCTGGGTAG
Gene >Agabi119p4|670400
ATGCATACAGCATACACCGTGGCGTCTCAACGTCCTTCGAAACCGAAAGGTCCAGGTCCTCTCTCTGGTCCAAAC
AGTCTTTTGCCTACGCTGGAGGTCATTCCGACTTCCTCCCCTGCGTCTTCTTCGCGAGACCATACCGACACTGCT
CTTTTACGTTCCAGAAAACTGGTTCCGAAATCTACTGTACCGATACACAACGACCACAGTCAAGGTATTTTGGCG
CATATATCGCGCATATACCCACTTCTGATACTAGCAACACCGACCTACTTCTTGCAGTTCCACAGAGCGTTGTTG
AGCCTCAACTGAACGTACACGAAGTAATTGACCACGAAGACCTTGATTCCAGCGACGATCAACTTCTACTTGCAT
CTCTACCTCAGTCACCCGCACCGACTACATCACAACAGCTCACTCTGTCAGCGAACTTGCCGTTGACTACTGCTT
CCTCTCCTGACACCGAATCCGACTCTGAATCCGACTCCGATTCATCTTCCGATTTTGACATGGGTAAATCACCTA
TCACCATCAGCGCCGGAATTGAACTGTCGAAAGTTGGTGGATTACCTCGGGTCACTGCTACCACTCTCACTCCGT
CGATCCTCCGTGACCTCGAGGACTACGCGAACGTTTGTTACCAGGTTGGCAGGAAAGTCGCTCCAGCAAAACAAC
TGAAGAAGTTGGCGGCTTGCTTCTCGAACATTGAACATATGTCATGGGTTTTAACGGAAGCTGATCTACAACCAG
AGGGAACCACGTTGAGTGCTTTCTTGGACAAAATGCGTAAACGTTTCTTACCCAATAATTGGGAGCTCCTCATCG
AGGCCAAACGCGAGGCCGAAATCATGCATGAGGACGACACATACATGGATTGGGCTACTCGTATTAAGAAGAAGA
ACAACATTCTTAAAGGAACCCCTTGCCATTTAAACGACAAATGCTTGCGCCTCTTCTTACTGTCCCATCTCGAGC
ATGGCCTGAAGGGCATTGTATTCTCGGCTACAGACGACAAAGGTACCAAAGTTACAGATATCAAAGAGTTCAGCC
ACTGGGAACAGGAGGTCCAGCGCTTGGATACATTACGAGCTTCACAACGTGCATCTCAACGACAGCTTGTCTTGA
GCATGATGAACGACAACGACCGCCACCGTGATTCCAAACCAGGAAAGTCGAAAGGCAAGAAGCAGAGCGACGGAA
AAATCTCTTCTGACAGATGTCCTCCTCTTACTGGCGACGAACGTACCATCCTATACAAGTATGACGGCTGTTTGA
AATGTCGTAAGGTTTTCCAGGACCACATCTCGAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGGTATCGTG
CTGTACAAGAACCTCCCCAGTCGGATATTGACGCTTGGAAGAAGAAACCTTCCGGTAGTCGGGATAAACGATCAC
GCTCTGATCATGCCTCGCATGCGTCTTCTTCTCATCCTAGCAAACGTGCTAAAAAGGATGTTGCTGCTGCGATAT
TGGAATCGGAGAGTGATAGTTCCGAAGCTGACGATGTGATTGCTGCAATTGAGGATGACGGCGATACTACCGACG
AAGTGCGTGGCAGACACCTTTACTGGGATTGCTCACTAACGGGTCCTAACAGTGAATCTCCTGTTAACACTACGG
CATTACTGGACAGTGGGGCACATGTTGTCCTTATTCGCGACACCTTAGTTTCAGAGCTCGGACTCAAACGTTTTC
CGCTTAGCGATACCTTCTCTGTTCGTGGTGCCATGTCTACCCATCGCTCGTTTATAAATGAATATGTTTACATCG
TTCTCTCCTCATGTGATATGTCCTACACTGCACGTCCTGTGAGAGCTCTTATAATTGGCGAATTGTCTGCACCAA
TTATTCTGGGAATGCCTTTCCTGTCCCGAAATGCTATTCAAATTAATCATCACACAAGAGTCGTCACAGATACAT
TGCAAAATGTCAATTTGCTCGGGTCTGGTAGCACTACGCATACCAAACCCATAAAACGAGACACTGATGCGCATC
CGAACCCAAAACATAAGAAGCGCAATACTCAGCTTACCACTGCGCCTTACCGAAAATTACTTGTGGAGAGTCTTA
AAGATAAACTGCGTACCACGAAAATGACTCTGTCTCCACACCAACATACATCTTCTTCTGATGCGCACGAAGTGG
TTGCTGCGATTCACAAGCGCATAACACAAGTCATTGATGAAGAAGTATTACGTCGGTTACATGCCAAAATTGTCT
CCGAGTTTGCTTCTGTTTTTTCTGCCATGCCTAAAGTATCTTGTCTTCCTAAAGACATTGAAGCTGACATTAGAC
TTAAAGATCCCCAGTTGACTGTTAAGCCACGTACCTATAGTTGCCCTCGTCGTTATAAGGAGGCTTGGAAGAAAC
TTATTGATGACCACCTGGAGGCTGGTCGTATTCAACCGTCTGCTTCGCCTTTCGCGTCACCTTCTTTTTGCATCC
CAAAATCTGATCCTTCCGCTCCACCTCGTTGGGTAAACGATTATCGAGAATTGAACAAAAACACCGTCCCTGACA
ATTATGCATTGCCTAAGGTTGACGATGTCTTGAATGACTGTGCTAAAGGAAAATATTTTGCTGTCATCGACATGA
CAAATGCCTTTTTCCAAACTCGCATGCGAGCAAAAGACATTCACAAAACAGCTGTAACCACTCCGTTTGGTTCTT
TTGAATGGAAGGTCATGCCGATGGGTTTGCGCAACGCACCTGCGATCCACCAACGTCGTATTAACAAGGCTTTAC
GTGCCCACATTGGGAAAATCTGTCAAGCTTATATCGACGACATTGTGATTTGGTCGCATACACTGTCTGAACACG
AAACTAATGTACGGTTGATTTTGTCAACATTACAACAAGCGGGTTTGTACTGCAACCTGAAGAAGACAAAATTGT
TCTGCACCGAAATAAATTTCCTTGGACACCACATCAGTTCTGACGGTATACGAGCAGACGACCGTAAGGCTGAGA
AAATTGTCAACTGGCCGATCCCACAGAATGCTAAGGATGTCCGTCAGTTCTTAGGCCTCGTTCGCTACGTGGCTG
TCTTTTTACCAGACCTTGCTCGTTATTCGACGATTCTTAATAAGCTCACTGATAAATCATCTGTCACGGACTTTC
CTGACTGGAATGACTCGCATCAACATGCGTTCGACAAAATTAAAGAATTAGTGCTCTCACGCGACTGCTTGACGA
CTATTGATTACACCGCAATGCCACTGAAGCGAGTTTTTGTCTCTACCGATGCTTCCGATTTTGCAAGCGGTGCCG
TCCTCTCTTTTGGCGAGACTTTTGAAACCGCGCAACCTGTGGCTTTTGAATCTAAGTCGTTCAAGGGTGCTGAAC
TTAACTATCCGGTCCACGAGAAGGAGCTTTTTGCAATTGTTAGAGCACTCGAAAAATGGCGGGTCGACCTGCTTG
GCGTACCTTTTACGGTCCTCACTGACCACCGGACACTCGAGTGTTTCAACACACAACGGCACTTATCCCGTCGCC
AAGCCCGGTGGATGGAGTTTCTACAACAATACGATTTCAGCATTGTTTATCTTCGAGGTGAAGACAATGTCGCCG
CCGACGCGTTATCACGGACCACATTTACAAATGCAATTTCCGAGCAAGATGCTTTCCATATGTCCCCCTGTGATC
GTTTGGATGAACTGGACATTTCAGTGTGTGCGACATTGGACAATGCACTCACACCTCAAGCGGAATGGGCTGCCA
TGCTGTCCCTCCTCCCTAACGACACTATTGCCCACACGCTTGATATCGCAGCTGATGATGAGCTTCGTGACTCTA
TTCTTGCTGGCTACACAAACGATACATGGTGCACGAAACTACTGGCCACTTGGCAACAAATGCACAATGTGGTGT
TGCGCGGTGGTTTGCTGTTTTTCGAAGATCGTCTCATCATCCCCCGTACCGGGAACGTACGGGAAACAATATTCG
CCCTCGCTCATGATTCTTTGGGTCACTTCGGGCTCGATAAATCCTACGAGGCGCTACGTGGCTCGTTTTACTGGC
CTGGAATGCACACGGATCTGGAAAAATTGTACGTGCCTAAATGTGCACAATGTCAACGAATGAAATCTTCCACGA
AGAAACCTATCGGTCCTCTGCATCCCCTTCCCATACCTGACCATCGTTTCCAAGCGGTTGCTATCGATTTCGTTG
GGCCATTGCCTGAGGAACTTGGATTCAATTGTATCTTCACGATGACCGACCGCCTTGGAGCCGATGTTCGCCTTG
TCCCGACCACCATGAACGCTACAGCTGTGGATACCGCTCAGCTCTTTTTCCACCACTGGTATTGCGAAAATGGTT
TACCTCAAGAAATTGTATCTGATCGAGACAAATTGTTCACATCCTCCTTTTGGCGTTCACTCCACGAATTAACTG
GTACCGCTTTGAAAATGTCTACATCGTTCCATCCACAGACTGATGGTGCCAGCGAACGTACCAATAAAACTCTGA
ACCAGTGTCTGCGCATGCATGTTGACAGCATGCAGCGAGGATGGGTTAAAGCCTTACCAGCTATCCGGTTCGCTA
TGATGAATACTCAGAACGCCTCAACTGGGCTCACGGGTTTCCAACTCCGTATGGGTTGCTCACCTCGAGTAATTC
CGCCTATCTACCGTGATAACTCTGATTTGCCCACCGAGTCTCCCGAAGATTTCCTGTTCAGAGTCTCTTCGTTAG
AAGCACAAGCTCGAGACACATTGTTACAGCATAAAGTCCTCCAGGCTCACCAAGCTAACAAACATCGCGATACAT
CTCCTTTCCCATTCGTTGTGGGTGGGCGAGTGAAGTTGTCTACTGCAAATCGACGCAAAAAGCTCTCCGTCGAAG
GAGCGAAACGTGTTGCTAAGCTCATGCCTCGGTTTGAAGGACCCTATGTGATTAGAGCTGTAAACGAAGAAAACA
GTACTGTCACGTTGGAAATCCCGCGACGGGGTCATCCTAATGGTACGGAATCGTTTCATACATCCCTTGTTCGTC
AATGGGTGGAAGACGACGCGCAAGTTTTCGACCGACCACCTCTCAACGACGCCGGAGAAGCTGAGGTGGAAGAAA
TAGTGGAGCGTCGAAAGATTGGTCGCGGTTGGAGTTACCGTGTGAAATACAGGGGTTACCCCAAAGAAGAGAACC
AATGGTTACCTGGCAGAGAAGTCGAGAATCTTGAAGCACTCGACCGCTTTTTCGCCCGTGAAGGTCTTACAGAAC
TGGGACAGACCGTTTCATTGTCATCTGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail