Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|667700
Gene name
Locationscaffold_06:1618541..1619345
Strand-
Gene length (bp)804
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family 2.3E-10 65 207

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14045|TPT1_SCHPO Putative tRNA 2'-phosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.12c PE=3 SV=2 42 222 4.0E-11
sp|Q3ZBM7|TRPT1_BOVIN tRNA 2'-phosphotransferase 1 OS=Bos taurus GN=TRPT1 PE=2 SV=3 48 221 1.0E-08
sp|Q8K3A2|TRPT1_MOUSE tRNA 2'-phosphotransferase 1 OS=Mus musculus GN=Trpt1 PE=2 SV=2 20 221 3.0E-06

GO

GO Term Description Terminal node
GO:0016740 transferase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|667700
MPPLPVLPRARPSKAHLKFRNHAWRQPWNGTQIRWALNTLRHLRHSPLLPPDAWLPLADFATQDDFHTVLALTDN
DRARRFETELSDPATPYIRAREGHSVPDVRLSNVRVRFPSAIPSLIYATAPANWPAIERDGIRPRLPPLLVPNPS
NPNFIYFAHYMANLSPPTLSHLPSNALQLHITINVPAAMKAGIKFYATNTNQIISTGFINSTIPTQFFKDVSVVS
VKCERLTTVY*
Coding >Agabi119p4|667700
ATGCCCCCTCTTCCAGTGCTGCCCCGCGCTCGCCCTTCCAAGGCCCATCTCAAATTCCGCAACCACGCCTGGCGC
CAGCCCTGGAATGGCACCCAGATACGCTGGGCCCTCAACACCCTCCGCCATCTCCGCCACTCCCCCCTCCTTCCC
CCCGATGCTTGGCTTCCCCTCGCCGACTTTGCCACCCAGGACGACTTTCACACCGTCCTTGCCCTGACTGACAAC
GACCGCGCCCGCCGCTTCGAGACCGAGTTGTCCGATCCAGCGACACCCTACATCCGCGCACGAGAAGGCCACTCT
GTTCCAGATGTTCGCCTCTCCAATGTTCGAGTCCGCTTTCCCTCTGCCATCCCCTCTCTCATCTACGCCACCGCA
CCCGCAAACTGGCCAGCCATCGAGCGCGACGGCATCCGTCCACGGCTTCCACCCCTCCTCGTCCCCAATCCCTCA
AATCCAAATTTCATATATTTCGCACACTACATGGCCAATCTCTCCCCCCCAACCCTCTCCCACCTCCCCAGCAAC
GCTCTACAACTCCACATCACCATCAATGTCCCCGCCGCTATGAAAGCAGGTATCAAGTTCTATGCTACAAACACC
AACCAGATCATCTCCACCGGCTTCATCAATTCAACCATCCCCACTCAATTCTTCAAGGACGTCTCCGTCGTCTCC
GTCAAGTGCGAGCGCCTCACCACAGTTTATTGA
Transcript >Agabi119p4|667700
ATGCCCCCTCTTCCAGTGCTGCCCCGCGCTCGCCCTTCCAAGGCCCATCTCAAATTCCGCAACCACGCCTGGCGC
CAGCCCTGGAATGGCACCCAGATACGCTGGGCCCTCAACACCCTCCGCCATCTCCGCCACTCCCCCCTCCTTCCC
CCCGATGCTTGGCTTCCCCTCGCCGACTTTGCCACCCAGGACGACTTTCACACCGTCCTTGCCCTGACTGACAAC
GACCGCGCCCGCCGCTTCGAGACCGAGTTGTCCGATCCAGCGACACCCTACATCCGCGCACGAGAAGGCCACTCT
GTTCCAGATGTTCGCCTCTCCAATGTTCGAGTCCGCTTTCCCTCTGCCATCCCCTCTCTCATCTACGCCACCGCA
CCCGCAAACTGGCCAGCCATCGAGCGCGACGGCATCCGTCCACGGCTTCCACCCCTCCTCGTCCCCAATCCCTCA
AATCCAAATTTCATATATTTCGCACACTACATGGCCAATCTCTCCCCCCCAACCCTCTCCCACCTCCCCAGCAAC
GCTCTACAACTCCACATCACCATCAATGTCCCCGCCGCTATGAAAGCAGGTATCAAGTTCTATGCTACAAACACC
AACCAGATCATCTCCACCGGCTTCATCAATTCAACCATCCCCACTCAATTCTTCAAGGACGTCTCCGTCGTCTCC
GTCAAGTGCGAGCGCCTCACCACAGTTTATTGA
Gene >Agabi119p4|667700
ATGCCCCCTCTTCCAGTGCTGCCCCGCGCTCGCCCTTCCAAGGCCCATCTCAAATTCCGCAACCACGCCTGGCGC
CAGCCCTGGAATGGCACCCAGATACGCTGGGCCCTCAACACCCTCCGCCATCTCCGCCACTCCCCCCTCCTTCCC
CCCGATGCTTGGCTTCCCCTCGCCGACTTTGCCACCCAGGACGACTTTCACACCGTCCTTGCCCTGACTGACAAC
GACCGCGCCCGCCGCTTCGAGACCGAGTTGTCCGATCCAGCGACACCCTACATCCGCGCACGAGAAGGCCACTCT
GTTCCAGTAGGTTCATGTCTTCACTCTCGCTTTCACTTCTCACGCGTTTCACAGGATGTTCGCCTCTCCAATGTT
CGAGTCCGCTTTCCCTCTGCCATCCCCTCTCTCATCTACGCCACCGCACCCGCAAACTGGCCAGCCATCGGCACG
TCGCCTCTTCTCTCTCGCTACCTCCCTATTTACTTTTTTATAGAGCGCGACGGCATCCGTCCACGGCTTCCACCC
CTCCTCGTCCCCAATCCCTCAAATCCAAATTTCATATATTTCGCACACTACATGGCCAATCTCTCCCCCCCAACC
CTCTCCCACCTCCCCAGCAACGCTCTACAACTCCACATCACCATCAATGTCCCCGCCGCTATGAAAGCAGGTATC
AAGTTCTATGCTACAAACACCAACCAGATCATCTCCACCGGCTTCATCAATTCAACCATCCCCACTCAATTCTTC
AAGGACGTCTCCGTCGTCTCCGTCAAGTGCGAGCGCCTCACCACAGTTTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail