Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|667400
Gene name
Locationscaffold_06:1599859..1604528
Strand+
Gene length (bp)4669
Transcript length (bp)4428
Coding sequence length (bp)4428
Protein length (aa) 1476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 2.2E-31 1019 1124
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 7.2E-26 995 1093
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 5.1E-22 789 950
PF17921 Integrase_H2C2 Integrase zinc binding domain 1.5E-19 1238 1296
PF00098 zf-CCHC Zinc knuckle 1.7E-05 261 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 709 1463 4.0E-125
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 709 1463 4.0E-125
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 709 1463 4.0E-125
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 709 1463 4.0E-125
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 709 1463 6.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 709 1463 4.0E-125
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 709 1463 4.0E-125
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 709 1463 4.0E-125
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 709 1463 4.0E-125
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 709 1463 6.0E-125
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 709 1463 6.0E-125
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 709 1463 6.0E-125
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 709 1463 6.0E-125
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 709 1463 1.0E-124
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 709 1463 1.0E-124
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 709 1463 2.0E-124
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 733 1471 1.0E-108
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 733 1471 4.0E-107
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 746 1473 6.0E-68
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 743 1470 1.0E-66
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 723 1387 5.0E-64
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 724 1387 7.0E-58
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 724 1144 8.0E-46
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 737 1144 7.0E-30
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 737 1144 1.0E-29
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 737 1144 2.0E-29
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 737 1144 2.0E-29
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 737 1144 1.0E-28
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 737 1144 1.0E-27
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 761 1144 2.0E-27
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 690 1142 5.0E-26
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 770 1148 2.0E-25
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 753 1144 2.0E-22
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 1242 1473 1.0E-21
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 1245 1467 3.0E-21
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 1206 1466 4.0E-21
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 1228 1473 4.0E-21
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 1219 1473 6.0E-21
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 753 1038 6.0E-21
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 1228 1473 2.0E-20
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 754 1157 5.0E-20
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 754 1157 5.0E-20
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 60 424 1.0E-19
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 746 975 5.0E-19
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 795 1139 5.0E-19
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 743 954 6.0E-19
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 1194 1475 2.0E-18
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 743 954 3.0E-18
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 797 892 4.0E-18
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 744 975 3.0E-17
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 1226 1469 5.0E-17
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 1207 1469 1.0E-16
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 1226 1469 1.0E-16
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 784 971 2.0E-16
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 737 1155 2.0E-16
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 809 1134 1.0E-15
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 1246 1469 9.0E-15
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 745 954 1.0E-14
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 1226 1469 3.0E-14
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 1229 1440 3.0E-14
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 320 424 5.0E-14
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 738 1080 4.0E-13
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 738 1080 4.0E-13
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 738 1080 4.0E-13
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 738 1080 4.0E-13
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 738 1080 4.0E-13
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 1228 1474 5.0E-13
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 791 1145 5.0E-13
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 1226 1469 2.0E-12
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 738 1080 2.0E-12
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 1229 1440 3.0E-12
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 263 426 3.0E-12
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 738 1057 4.0E-12
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 1217 1469 4.0E-12
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 1217 1469 5.0E-12
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 738 1057 7.0E-12
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 795 965 7.0E-12
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 1278 1469 9.0E-12
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 1278 1469 9.0E-12
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 738 1080 1.0E-11
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 738 1080 3.0E-11
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 1217 1469 3.0E-11
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 320 424 1.0E-10
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 1217 1469 1.0E-10
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 738 1057 2.0E-10
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 1242 1441 2.0E-10
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 737 1080 2.0E-10
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 1245 1441 3.0E-10
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 1224 1466 3.0E-10
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 63 426 5.0E-10
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 719 958 6.0E-10
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 752 963 6.0E-10
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 1204 1423 7.0E-10
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 752 963 1.0E-09
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 719 958 1.0E-09
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 752 945 2.0E-09
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 1262 1469 3.0E-09
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 726 965 3.0E-09
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 752 961 6.0E-09
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 1278 1469 7.0E-09
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 1278 1469 7.0E-09
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 1278 1469 7.0E-09
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 1319 1426 9.0E-09
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 719 972 9.0E-09
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 710 1161 5.0E-08
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 752 963 9.0E-08
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 1224 1470 9.0E-08
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 752 961 1.0E-07
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey sarcoma virus GN=pol PE=3 SV=1 1319 1469 2.0E-07
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 752 961 3.0E-07
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 752 918 3.0E-07
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 745 963 4.0E-07
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 752 963 4.0E-07
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 745 963 5.0E-07
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 752 918 8.0E-07
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 752 963 1.0E-06
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 738 925 2.0E-06
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 752 924 2.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 752 934 3.0E-06
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 752 963 5.0E-06
sp|P35956|POL_VILVK Pol polyprotein OS=Maedi visna virus (strain KV1772) GN=pol PE=1 SV=1 719 920 8.0E-06
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 725 934 8.0E-06
sp|P23427|POL_VILV2 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS2) GN=pol PE=3 SV=1 719 920 9.0E-06
sp|P03370|POL_VILV Pol polyprotein OS=Maedi visna virus (strain 1514) GN=pol PE=3 SV=1 719 920 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|667400
MSTAQQIMEQLTAQQNLITQLQQQLATLQNNHAQGPPGPQGPPGEDADLPVVNIPPQIDVAKPKIFSGDGRELSG
FITACKIYLSLKMSGRLQADQITWILSYVQGGAVESWKENIMEMIENNEEEAPAHTEELFDSLRNNFGDADEEST
AVGKLRLIKQGNKSAEEHMQEFKSLSGRIRKALMEAENPPTTIRSWYERSMKLDRQWRQAKVEEEYYRQGQVKPQ
PRTHTTSNTFVRPQPQHRDPNAMDVDTAAGPSRGPIKCYKCGKLGHMAKNCWSKAPARDVRTLDVDEQRDYWKRM
FEEEQKNLKEEIKLNVGVEKLDTHDGVGVQALLDSGATGMFMDKAFAEEEGFKLEPLERPIPVKNVDGTINASGA
VMHRVAANMYYKGHKERVHFEICGLGKNKVILGMPWLQMHNPEIDWEKGEVKMTRCPDGCGYKDKGKGKERQEEI
QKVEEPRKSTRQLMKEAREEEKRERPDMSHKQYAGWKLVSFPKKSSWGTVLQYRCEECGTQTSEHLLSKQKCPVI
EEIALDEFGMPYKGSDDKKEEQTMAKIEAYEKEQEEIRDEEERYERVNKAIGRFTQPKNIIEGITLGVEAAFARE
LAHNRRANGGAERLAQQPKEKAEGWAQSPGDVADRLNGDKAECLEEDNIKTATAGKAEAGQVCPKRISAQRKNRS
REEEEQLETWVRGMTEEMPEEEEIRSIDSVEQMVPRRFHKFLKVFKQKESERMPTRKPWDHAIELKEDFKPKKGK
IYPLSQNEREEVQAFVKDQLRKGYIRPSKSLQTSPVFFVPKKDGKKRMVQDYRFLNDWTIKNNYPLPLISELIDT
MGSKRLFSKIDLRWGYNNIRIKEGDEWKAAFTTFMGAFEPTVMFFGLTNLPATFQTMMNKLFRDLVNTGKVAVFI
DDILIGTDDEEEHDKVVEEVLQRLMDNDLFAKPEKCEWKQNEMGFLGCIIGRNGIKMEERKVKDVVEWPTPKCIK
DYCKTTTCISQKGQEMELGREEEQAFATLKAKFTSHPILVAPELDKELKVESDASAYATGGELSMKCKDGKWRPV
AYIFKSMMETEQNYDIHDREILGIMRCLEDWRHFLEGAKHKFKIWTDHRNLKYFTKAQKLNRRQARWVLYLSRFN
FELKFRPGKTMGKADALSRRPDFEQGTKDDNKDQTLLKPEYFAIRAMEEGHMLINAEEKEMLDEIRKSEAKEDDV
VKAVEEMKRAKVKLLRGDEWKLGEGLVLKEGKVYVPKDETLRTKIIRLHHDTPIAGHGGQWKTVEMVTRNYWWPG
VTKQVQKYVEGCNQCQRNKNRPTPPAGKLMPNPIPTKPWADVSVDFIVKLPESQGMDSILVVCDRFSKMAHFIPI
TETTSALGLAKLFRDHVWKLHGLPEMVISDRGPQFAADFTKELNKMLGIDTRLSTAFHPQTDGQTKRTNQELEQY
LQSFVDHKQTDWPDWLATAEFSYNNKEQSSTKETPFMVNVGRHPRTGFDL*
Coding >Agabi119p4|667400
ATGTCTACGGCTCAACAAATCATGGAGCAGTTAACTGCTCAGCAAAACCTCATCACACAACTGCAGCAGCAGCTC
GCTACACTGCAGAACAATCACGCTCAAGGGCCACCAGGACCGCAAGGTCCACCAGGGGAGGATGCGGATCTCCCT
GTCGTCAATATACCGCCACAAATCGATGTGGCAAAACCAAAAATATTCTCAGGAGATGGGAGGGAGTTAAGCGGA
TTTATTACAGCATGTAAAATATATCTAAGCTTAAAAATGTCAGGAAGGTTACAGGCAGATCAAATCACGTGGATT
CTGTCATACGTACAAGGAGGAGCGGTGGAGTCATGGAAGGAAAATATTATGGAGATGATCGAGAACAACGAGGAA
GAAGCTCCAGCCCACACGGAGGAGCTTTTTGATAGCCTCCGTAACAATTTTGGAGATGCAGACGAGGAGAGTACG
GCGGTAGGAAAGTTGAGGTTGATCAAGCAAGGAAACAAAAGTGCGGAGGAACACATGCAGGAGTTCAAGAGTCTA
TCAGGGAGAATTAGGAAGGCATTGATGGAGGCGGAAAATCCACCAACCACTATCAGGAGTTGGTACGAGAGGAGT
ATGAAGCTAGATAGGCAATGGAGGCAGGCAAAGGTGGAGGAGGAGTATTATCGACAGGGGCAAGTCAAGCCCCAA
CCACGAACCCACACCACTAGCAACACTTTCGTGAGGCCTCAGCCTCAACATCGAGATCCCAACGCGATGGATGTC
GACACCGCAGCAGGGCCCAGCCGAGGCCCTATCAAGTGTTACAAGTGTGGGAAGTTGGGGCATATGGCAAAGAAT
TGCTGGAGCAAGGCTCCGGCTCGAGATGTGCGGACTTTAGATGTGGACGAGCAGCGGGATTATTGGAAGAGGATG
TTTGAGGAAGAGCAGAAGAATTTAAAAGAGGAAATTAAGCTGAACGTGGGAGTAGAGAAGTTGGATACGCATGAT
GGAGTGGGAGTGCAAGCATTATTGGATAGTGGAGCAACGGGGATGTTCATGGATAAGGCATTTGCAGAAGAAGAA
GGGTTCAAGCTGGAACCTTTAGAAAGACCAATCCCAGTCAAAAATGTTGATGGAACGATCAACGCATCTGGAGCA
GTAATGCACCGAGTTGCTGCAAACATGTATTACAAAGGGCATAAAGAAAGAGTACACTTTGAAATATGTGGCCTT
GGGAAAAATAAAGTCATATTAGGAATGCCTTGGTTACAAATGCACAATCCGGAAATTGATTGGGAGAAAGGAGAG
GTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGACAAAGGAAAAGGAAAAGAAAGACAAGAAGAAATA
CAAAAGGTGGAGGAACCGAGAAAATCAACTAGGCAGTTGATGAAGGAAGCACGAGAAGAAGAGAAAAGGGAAAGA
CCTGACATGTCACACAAACAATATGCAGGTTGGAAATTAGTTTCCTTCCCAAAGAAATCAAGTTGGGGAACAGTG
TTGCAGTATAGATGCGAGGAGTGTGGGACCCAGACATCGGAACATTTGCTGAGCAAACAAAAATGCCCAGTAATA
GAGGAAATCGCCTTGGATGAGTTTGGAATGCCATACAAAGGAAGTGATGACAAAAAGGAGGAGCAAACCATGGCC
AAAATAGAAGCATATGAGAAGGAACAGGAAGAAATCAGAGATGAGGAAGAAAGATACGAACGAGTAAACAAAGCG
ATAGGAAGGTTCACTCAACCAAAGAATATTATCGAAGGAATCACATTAGGAGTCGAAGCAGCATTTGCTAGGGAA
TTGGCACATAACAGGCGTGCTAATGGTGGAGCTGAGAGGTTGGCGCAACAACCCAAAGAGAAAGCTGAGGGGTGG
GCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGATAAGGCAGAATGTCTAGAAGAAGACAACATCAAG
ACAGCCACCGCGGGAAAAGCGGAGGCTGGACAGGTATGTCCTAAAAGAATAAGCGCCCAAAGAAAAAATAGGAGT
AGGGAAGAGGAAGAGCAGCTAGAAACGTGGGTGAGAGGAATGACAGAAGAAATGCCAGAGGAAGAAGAAATTCGA
AGCATAGACTCAGTGGAACAAATGGTACCAAGACGGTTCCACAAATTCCTTAAAGTATTCAAGCAAAAGGAGTCG
GAGAGAATGCCCACCAGGAAACCATGGGATCATGCTATCGAATTAAAAGAGGATTTTAAACCCAAGAAGGGAAAG
ATATATCCACTGTCACAAAACGAAAGAGAAGAAGTCCAAGCATTCGTCAAGGACCAACTTCGAAAGGGATATATT
AGGCCATCGAAATCCCTTCAAACTTCACCAGTATTTTTTGTGCCAAAGAAGGATGGAAAGAAACGGATGGTGCAG
GACTATAGGTTTTTGAACGATTGGACAATCAAGAACAATTATCCTTTACCTTTAATTTCTGAACTTATAGACACT
ATGGGTAGCAAACGATTATTTTCTAAAATAGACTTACGTTGGGGTTATAATAATATTAGGATAAAGGAAGGAGAC
GAGTGGAAGGCAGCCTTTACTACTTTCATGGGTGCCTTCGAACCAACAGTTATGTTTTTTGGACTTACAAATTTG
CCTGCTACTTTTCAGACTATGATGAACAAACTTTTTAGGGACTTAGTAAATACTGGGAAAGTAGCTGTATTTATT
GACGATATTTTGATAGGAACTGACGATGAAGAAGAACATGACAAAGTGGTGGAGGAAGTATTGCAGAGATTAATG
GACAATGACCTATTCGCAAAACCAGAAAAATGCGAATGGAAGCAAAACGAGATGGGGTTCTTAGGGTGTATAATA
GGGAGGAACGGAATCAAGATGGAAGAAAGGAAGGTGAAGGACGTAGTAGAATGGCCAACCCCAAAATGCATTAAG
GACTATTGCAAGACCACTACATGCATTAGTCAAAAAGGACAAGAAATGGAGTTGGGGAGAGAAGAAGAACAAGCC
TTTGCTACGCTAAAAGCAAAGTTCACATCGCATCCAATTCTGGTAGCACCAGAACTGGATAAGGAGCTGAAGGTA
GAATCTGACGCATCTGCCTATGCCACGGGCGGGGAGTTGTCAATGAAGTGCAAAGACGGGAAATGGAGACCAGTT
GCATACATCTTCAAATCCATGATGGAAACAGAACAAAATTATGATATTCATGACAGAGAAATTTTGGGGATTATG
CGGTGTTTAGAAGATTGGAGACACTTCCTGGAAGGGGCAAAACATAAGTTCAAAATTTGGACAGATCACCGCAAT
TTAAAATACTTCACAAAAGCCCAAAAACTAAACCGACGACAAGCCAGATGGGTGTTGTATCTATCTAGATTCAAT
TTCGAATTAAAATTCCGTCCAGGAAAAACAATGGGGAAGGCAGACGCATTGAGCAGAAGACCTGATTTCGAACAA
GGGACAAAGGACGATAACAAGGACCAAACCTTGTTGAAACCTGAATACTTCGCAATTCGAGCAATGGAGGAAGGT
CATATGTTAATCAATGCGGAGGAAAAGGAAATGTTAGATGAAATTAGAAAATCAGAAGCAAAGGAAGATGATGTG
GTAAAAGCGGTAGAGGAAATGAAACGAGCAAAAGTGAAGTTGTTGAGGGGAGACGAGTGGAAGTTGGGGGAAGGA
TTAGTGTTGAAGGAAGGAAAAGTCTATGTACCAAAGGACGAAACACTGAGGACAAAAATCATTCGACTACATCAC
GACACTCCCATTGCCGGGCATGGAGGACAATGGAAAACAGTCGAAATGGTAACACGCAACTACTGGTGGCCAGGT
GTCACTAAGCAAGTCCAGAAATACGTGGAAGGATGCAATCAATGCCAACGGAATAAGAATCGACCAACACCACCA
GCAGGAAAGCTAATGCCAAATCCTATCCCTACAAAACCGTGGGCTGATGTATCTGTCGACTTCATAGTAAAATTG
CCAGAATCTCAGGGAATGGATTCAATCTTAGTAGTGTGCGACCGATTCAGTAAAATGGCTCATTTTATTCCAATC
ACGGAAACGACATCGGCGCTAGGATTAGCTAAACTGTTCCGAGACCACGTATGGAAATTGCATGGACTACCAGAA
ATGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGATTTTACGAAGGAATTGAACAAAATGTTGGGAATCGAC
ACTAGGTTATCTACGGCATTCCACCCACAGACCGACGGCCAAACCAAACGAACCAATCAAGAGTTAGAACAATAT
CTCCAATCATTTGTTGATCATAAACAAACTGATTGGCCTGATTGGTTAGCAACGGCAGAGTTTTCCTATAATAAT
AAAGAACAATCATCAACAAAGGAAACTCCATTTATGGTTAACGTGGGAAGACATCCAAGAACTGGTTTCGATCTT
TGA
Transcript >Agabi119p4|667400
ATGTCTACGGCTCAACAAATCATGGAGCAGTTAACTGCTCAGCAAAACCTCATCACACAACTGCAGCAGCAGCTC
GCTACACTGCAGAACAATCACGCTCAAGGGCCACCAGGACCGCAAGGTCCACCAGGGGAGGATGCGGATCTCCCT
GTCGTCAATATACCGCCACAAATCGATGTGGCAAAACCAAAAATATTCTCAGGAGATGGGAGGGAGTTAAGCGGA
TTTATTACAGCATGTAAAATATATCTAAGCTTAAAAATGTCAGGAAGGTTACAGGCAGATCAAATCACGTGGATT
CTGTCATACGTACAAGGAGGAGCGGTGGAGTCATGGAAGGAAAATATTATGGAGATGATCGAGAACAACGAGGAA
GAAGCTCCAGCCCACACGGAGGAGCTTTTTGATAGCCTCCGTAACAATTTTGGAGATGCAGACGAGGAGAGTACG
GCGGTAGGAAAGTTGAGGTTGATCAAGCAAGGAAACAAAAGTGCGGAGGAACACATGCAGGAGTTCAAGAGTCTA
TCAGGGAGAATTAGGAAGGCATTGATGGAGGCGGAAAATCCACCAACCACTATCAGGAGTTGGTACGAGAGGAGT
ATGAAGCTAGATAGGCAATGGAGGCAGGCAAAGGTGGAGGAGGAGTATTATCGACAGGGGCAAGTCAAGCCCCAA
CCACGAACCCACACCACTAGCAACACTTTCGTGAGGCCTCAGCCTCAACATCGAGATCCCAACGCGATGGATGTC
GACACCGCAGCAGGGCCCAGCCGAGGCCCTATCAAGTGTTACAAGTGTGGGAAGTTGGGGCATATGGCAAAGAAT
TGCTGGAGCAAGGCTCCGGCTCGAGATGTGCGGACTTTAGATGTGGACGAGCAGCGGGATTATTGGAAGAGGATG
TTTGAGGAAGAGCAGAAGAATTTAAAAGAGGAAATTAAGCTGAACGTGGGAGTAGAGAAGTTGGATACGCATGAT
GGAGTGGGAGTGCAAGCATTATTGGATAGTGGAGCAACGGGGATGTTCATGGATAAGGCATTTGCAGAAGAAGAA
GGGTTCAAGCTGGAACCTTTAGAAAGACCAATCCCAGTCAAAAATGTTGATGGAACGATCAACGCATCTGGAGCA
GTAATGCACCGAGTTGCTGCAAACATGTATTACAAAGGGCATAAAGAAAGAGTACACTTTGAAATATGTGGCCTT
GGGAAAAATAAAGTCATATTAGGAATGCCTTGGTTACAAATGCACAATCCGGAAATTGATTGGGAGAAAGGAGAG
GTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGACAAAGGAAAAGGAAAAGAAAGACAAGAAGAAATA
CAAAAGGTGGAGGAACCGAGAAAATCAACTAGGCAGTTGATGAAGGAAGCACGAGAAGAAGAGAAAAGGGAAAGA
CCTGACATGTCACACAAACAATATGCAGGTTGGAAATTAGTTTCCTTCCCAAAGAAATCAAGTTGGGGAACAGTG
TTGCAGTATAGATGCGAGGAGTGTGGGACCCAGACATCGGAACATTTGCTGAGCAAACAAAAATGCCCAGTAATA
GAGGAAATCGCCTTGGATGAGTTTGGAATGCCATACAAAGGAAGTGATGACAAAAAGGAGGAGCAAACCATGGCC
AAAATAGAAGCATATGAGAAGGAACAGGAAGAAATCAGAGATGAGGAAGAAAGATACGAACGAGTAAACAAAGCG
ATAGGAAGGTTCACTCAACCAAAGAATATTATCGAAGGAATCACATTAGGAGTCGAAGCAGCATTTGCTAGGGAA
TTGGCACATAACAGGCGTGCTAATGGTGGAGCTGAGAGGTTGGCGCAACAACCCAAAGAGAAAGCTGAGGGGTGG
GCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGATAAGGCAGAATGTCTAGAAGAAGACAACATCAAG
ACAGCCACCGCGGGAAAAGCGGAGGCTGGACAGGTATGTCCTAAAAGAATAAGCGCCCAAAGAAAAAATAGGAGT
AGGGAAGAGGAAGAGCAGCTAGAAACGTGGGTGAGAGGAATGACAGAAGAAATGCCAGAGGAAGAAGAAATTCGA
AGCATAGACTCAGTGGAACAAATGGTACCAAGACGGTTCCACAAATTCCTTAAAGTATTCAAGCAAAAGGAGTCG
GAGAGAATGCCCACCAGGAAACCATGGGATCATGCTATCGAATTAAAAGAGGATTTTAAACCCAAGAAGGGAAAG
ATATATCCACTGTCACAAAACGAAAGAGAAGAAGTCCAAGCATTCGTCAAGGACCAACTTCGAAAGGGATATATT
AGGCCATCGAAATCCCTTCAAACTTCACCAGTATTTTTTGTGCCAAAGAAGGATGGAAAGAAACGGATGGTGCAG
GACTATAGGTTTTTGAACGATTGGACAATCAAGAACAATTATCCTTTACCTTTAATTTCTGAACTTATAGACACT
ATGGGTAGCAAACGATTATTTTCTAAAATAGACTTACGTTGGGGTTATAATAATATTAGGATAAAGGAAGGAGAC
GAGTGGAAGGCAGCCTTTACTACTTTCATGGGTGCCTTCGAACCAACAGTTATGTTTTTTGGACTTACAAATTTG
CCTGCTACTTTTCAGACTATGATGAACAAACTTTTTAGGGACTTAGTAAATACTGGGAAAGTAGCTGTATTTATT
GACGATATTTTGATAGGAACTGACGATGAAGAAGAACATGACAAAGTGGTGGAGGAAGTATTGCAGAGATTAATG
GACAATGACCTATTCGCAAAACCAGAAAAATGCGAATGGAAGCAAAACGAGATGGGGTTCTTAGGGTGTATAATA
GGGAGGAACGGAATCAAGATGGAAGAAAGGAAGGTGAAGGACGTAGTAGAATGGCCAACCCCAAAATGCATTAAG
GACTATTGCAAGACCACTACATGCATTAGTCAAAAAGGACAAGAAATGGAGTTGGGGAGAGAAGAAGAACAAGCC
TTTGCTACGCTAAAAGCAAAGTTCACATCGCATCCAATTCTGGTAGCACCAGAACTGGATAAGGAGCTGAAGGTA
GAATCTGACGCATCTGCCTATGCCACGGGCGGGGAGTTGTCAATGAAGTGCAAAGACGGGAAATGGAGACCAGTT
GCATACATCTTCAAATCCATGATGGAAACAGAACAAAATTATGATATTCATGACAGAGAAATTTTGGGGATTATG
CGGTGTTTAGAAGATTGGAGACACTTCCTGGAAGGGGCAAAACATAAGTTCAAAATTTGGACAGATCACCGCAAT
TTAAAATACTTCACAAAAGCCCAAAAACTAAACCGACGACAAGCCAGATGGGTGTTGTATCTATCTAGATTCAAT
TTCGAATTAAAATTCCGTCCAGGAAAAACAATGGGGAAGGCAGACGCATTGAGCAGAAGACCTGATTTCGAACAA
GGGACAAAGGACGATAACAAGGACCAAACCTTGTTGAAACCTGAATACTTCGCAATTCGAGCAATGGAGGAAGGT
CATATGTTAATCAATGCGGAGGAAAAGGAAATGTTAGATGAAATTAGAAAATCAGAAGCAAAGGAAGATGATGTG
GTAAAAGCGGTAGAGGAAATGAAACGAGCAAAAGTGAAGTTGTTGAGGGGAGACGAGTGGAAGTTGGGGGAAGGA
TTAGTGTTGAAGGAAGGAAAAGTCTATGTACCAAAGGACGAAACACTGAGGACAAAAATCATTCGACTACATCAC
GACACTCCCATTGCCGGGCATGGAGGACAATGGAAAACAGTCGAAATGGTAACACGCAACTACTGGTGGCCAGGT
GTCACTAAGCAAGTCCAGAAATACGTGGAAGGATGCAATCAATGCCAACGGAATAAGAATCGACCAACACCACCA
GCAGGAAAGCTAATGCCAAATCCTATCCCTACAAAACCGTGGGCTGATGTATCTGTCGACTTCATAGTAAAATTG
CCAGAATCTCAGGGAATGGATTCAATCTTAGTAGTGTGCGACCGATTCAGTAAAATGGCTCATTTTATTCCAATC
ACGGAAACGACATCGGCGCTAGGATTAGCTAAACTGTTCCGAGACCACGTATGGAAATTGCATGGACTACCAGAA
ATGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGATTTTACGAAGGAATTGAACAAAATGTTGGGAATCGAC
ACTAGGTTATCTACGGCATTCCACCCACAGACCGACGGCCAAACCAAACGAACCAATCAAGAGTTAGAACAATAT
CTCCAATCATTTGTTGATCATAAACAAACTGATTGGCCTGATTGGTTAGCAACGGCAGAGTTTTCCTATAATAAT
AAAGAACAATCATCAACAAAGGAAACTCCATTTATGGTTAACGTGGGAAGACATCCAAGAACTGGTTTCGATCTT
TGA
Gene >Agabi119p4|667400
ATGTCTACGGCTCAACAAATCATGGAGCAGTTAACTGCTCAGCAAAACCTCATCACACAACTGCAGCAGCAGCTC
GCTACACTGCAGAACAATCACGCTCAAGGGCCACCAGGACCGCAAGGTCCACCAGGGGAGGATGCGGATCTCCCT
GTCGTCAATATACCGCCACAAATCGATGTGGCAAAACCAAAAATATTCTCAGGAGATGGGAGGGAGTTAAGCGGA
TTTATTACAGCATGTAAAATATATCTAAGCTTAAAAATGTCAGGAAGGTTACAGGCAGATCAAATCACGTGGATT
CTGTCATACGTACAAGGAGGAGCGGTGGAGTCATGGAAGGAAAATATTATGGAGATGATCGAGAACAACGAGGAA
GAAGCTCCAGCCCACACGGAGGAGCTTTTTGATAGCCTCCGTAACAATTTTGGAGATGCAGACGAGGAGAGTACG
GCGGTAGGAAAGTTGAGGTTGATCAAGCAAGGAAACAAAAGTGCGGAGGAACACATGCAGGAGTTCAAGTGAATT
GCTCGAGATAGCGGATACGAGGGGCGAGCCCTCATCGAAGAGTTCAAAAGGAGTCTATCAGGGAGAATTAGGAAG
GCATTGATGGAGGCGGAAAATCCACCAACCACTATCAGGAGTTGGTACGAGAGGAGTATGAAGCTAGATAGGCAA
TGGAGGCAGGCAAAGGTGGAGGAGGAGTATTATCGACAGGGGCAAGTCAAGCCCCAACCACGAACCCACACCACT
AGCAACACTTTCGTGAGGCCTCAGCCTCAACATCGAGATCCCAACGCGATGGATGTCGACACCGCAGCAGGGCCC
AGCCGAGGCCCTATCAAGTGTTACAAGTGTGGGAAGTTGGGGCATATGGCAAAGAATTGCTGGAGCAAGGCTCCG
GCTCGAGATGTGCGGACTTTAGATGTGGACGAGCAGCGGGATTATTGGAAGAGGATGTTTGAGGAAGAGCAGAAG
AATTTAAAAGAGTAAAGGAAGCAAAGTCTCCTCGTTTGACTTCCTACAACAAATTCGATGTACTATGTAACGAAA
TCAATGTTTTGAACACTGTACAAAAGGAGAGTTTCCTAGTAAGGACAATCCGACCTTTAAGGGAAATTAAGCTGA
ACGTGGGAGTAGAGAAGTTGGATACGCATGATGGAGTGGGAGTGCAAGCATTATTGGATAGTGGAGCAACGGGGA
TGTTCATGGATAAGGCATTTGCAGAAGAAGAAGGGTTCAAGCTGGAACCTTTAGAAAGACCAATCCCAGTCAAAA
ATGTTGATGGAACGATCAACGCATCTGGAGCAGTAATGCACCGAGTTGCTGCAAACATGTATTACAAAGGGCATA
AAGAAAGAGTACACTTTGAAATATGTGGCCTTGGGAAAAATAAAGTCATATTAGGAATGCCTTGGTTACAAATGC
ACAATCCGGAAATTGATTGGGAGAAAGGAGAGGTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGACA
AAGGAAAAGGAAAAGAAAGACAAGAAGAAATACAAAAGGTGGAGGAACCGAGAAAATCAACTAGGCAGTTGATGA
AGGAAGCACGAGAAGAAGAGAAAAGGGAAAGACCTGACATGTCACACAAACAATATGCAGGTTGGAAATTAGTTT
CCTTCCCAAAGAAATCAAGTTGGGGAACAGTGTTGCAGTATAGATGCGAGGAGTGTGGGACCCAGACATCGGAAC
ATTTGCTGAGCAAACAAAAATGCCCAGTAATAGAGGAAATCGCCTTGGATGAGTTTGGAATGCCATACAAAGGAA
GTGATGACAAAAAGGAGGAGCAAACCATGGCCAAAATAGAAGCATATGAGAAGGAACAGGAAGAAATCAGAGATG
AGGAAGAAAGATACGAACGAGTAAACAAAGCGATAGGAAGGTTCACTCAACCAAAGAATATTATCGAAGGAATCA
CATTAGGAGTCGAAGCAGCATTTGCTAGGGAATTGGCACATAACAGGCGTGCTAATGGTGGAGCTGAGAGGTTGG
CGCAACAACCCAAAGAGAAAGCTGAGGGGTGGGCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGATA
AGGCAGAATGTCTAGAAGAAGACAACATCAAGACAGCCACCGCGGGAAAAGCGGAGGCTGGACAGGTATGTCCTA
AAAGAATAAGCGCCCAAAGAAAAAATAGGAGTAGGGAAGAGGAAGAGCAGCTAGAAACGTGGGTGAGAGGAATGA
CAGAAGAAATGCCAGAGGAAGAAGAAATTCGAAGCATAGACTCAGTGGAACAAATGGTACCAAGACGGTTCCACA
AATTCCTTAAAGTATTCAAGCAAAAGGAGTCGGAGAGAATGCCCACCAGGAAACCATGGGATCATGCTATCGAAT
TAAAAGAGGATTTTAAACCCAAGAAGGGAAAGATATATCCACTGTCACAAAACGAAAGAGAAGAAGTCCAAGCAT
TCGTCAAGGACCAACTTCGAAAGGGATATATTAGGCCATCGAAATCCCTTCAAACTTCACCAGTATTTTTTGTGC
CAAAGAAGGATGGAAAGAAACGGATGGTGCAGGACTATAGGTTTTTGAACGATTGGACAATCAAGAACAATTATC
CTTTACCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACGATTATTTTCTAAAATAGACTTACGTTGGG
GTTATAATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACTACTTTCATGGGTGCCTTCGAAC
CAACAGTTATGTTTTTTGGACTTACAAATTTGCCTGCTACTTTTCAGACTATGATGAACAAACTTTTTAGGGACT
TAGTAAATACTGGGAAAGTAGCTGTATTTATTGACGATATTTTGATAGGAACTGACGATGAAGAAGAACATGACA
AAGTGGTGGAGGAAGTATTGCAGAGATTAATGGACAATGACCTATTCGCAAAACCAGAAAAATGCGAATGGAAGC
AAAACGAGATGGGGTTCTTAGGGTGTATAATAGGGAGGAACGGAATCAAGATGGAAGAAAGGAAGGTGAAGGACG
TAGTAGAATGGCCAACCCCAAAATGCATTAAGGACGTACAAAGATTCTTGGGACTAGTGAATTATTACCGACGAT
TCATTGAAAAATTTGCTAGTATTGCAAGACCACTACATGCATTAGTCAAAAAGGACAAGAAATGGAGTTGGGGAG
AGAAGAAGAACAAGCCTTTGCTACGCTAAAAGCAAAGTTCACATCGCATCCAATTCTGGTAGCACCAGAACTGGA
TAAGGAGCTGAAGGTAGAATCTGACGCATCTGCCTATGCCACGGGCGGGGAGTTGTCAATGAAGTGCAAAGACGG
GAAATGGAGACCAGTTGCATACATCTTCAAATCCATGATGGAAACAGAACAAAATTATGATATTCATGACAGAGA
AATTTTGGGGATTATGCGGTGTTTAGAAGATTGGAGACACTTCCTGGAAGGGGCAAAACATAAGTTCAAAATTTG
GACAGATCACCGCAATTTAAAATACTTCACAAAAGCCCAAAAACTAAACCGACGACAAGCCAGATGGGTGTTGTA
TCTATCTAGATTCAATTTCGAATTAAAATTCCGTCCAGGAAAAACAATGGGGAAGGCAGACGCATTGAGCAGAAG
ACCTGATTTCGAACAAGGGACAAAGGACGATAACAAGGACCAAACCTTGTTGAAACCTGAATACTTCGCAATTCG
AGCAATGGAGGAAGGTCATATGTTAATCAATGCGGAGGAAAAGGAAATGTTAGATGAAATTAGAAAATCAGAAGC
AAAGGAAGATGATGTGGTAAAAGCGGTAGAGGAAATGAAACGAGCAAAAGTGAAGTTGTTGAGGGGAGACGAGTG
GAAGTTGGGGGAAGGATTAGTGTTGAAGGAAGGAAAAGTCTATGTACCAAAGGACGAAACACTGAGGACAAAAAT
CATTCGACTACATCACGACACTCCCATTGCCGGGCATGGAGGACAATGGAAAACAGTCGAAATGGTAACACGCAA
CTACTGGTGGCCAGGTGTCACTAAGCAAGTCCAGAAATACGTGGAAGGATGCAATCAATGCCAACGGAATAAGAA
TCGACCAACACCACCAGCAGGAAAGCTAATGCCAAATCCTATCCCTACAAAACCGTGGGCTGATGTATCTGTCGA
CTTCATAGTAAAATTGCCAGAATCTCAGGGAATGGATTCAATCTTAGTAGTGTGCGACCGATTCAGTAAAATGGC
TCATTTTATTCCAATCACGGAAACGACATCGGCGCTAGGATTAGCTAAACTGTTCCGAGACCACGTATGGAAATT
GCATGGACTACCAGAAATGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGATTTTACGAAGGAATTGAACAA
AATGTTGGGAATCGACACTAGGTTATCTACGGCATTCCACCCACAGACCGACGGCCAAACCAAACGAACCAATCA
AGAGTTAGAACAATATCTCCAATCATTTGTTGATCATAAACAAACTGATTGGCCTGATTGGTTAGCAACGGCAGA
GTTTTCCTATAATAATAAAGAACAATCATCAACAAAGGAAACTCCATTTATGGTTAACGTGGGAAGACATCCAAG
AACTGGTTTCGATCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail