Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|663500
Gene name
Locationscaffold_06:1245869..1247735
Strand+
Gene length (bp)1866
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07576 BRAP2 BRCA1-associated protein 2 2.1E-26 56 140
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 2.3E-19 239 298
PF13639 zf-RING_2 Ring finger domain 4.9E-09 164 205
PF13445 zf-RING_UBOX RING-type zinc-finger 1.0E-05 165 202
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.7E-05 63 123
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.4E-05 165 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 55 512 3.0E-96
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 48 497 2.0E-91
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 48 497 3.0E-88
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 24 520 8.0E-85
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 58 530 9.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 55 512 3.0E-96
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 48 497 2.0E-91
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 48 497 3.0E-88
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 24 520 8.0E-85
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 58 530 9.0E-74
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 239 318 1.0E-08
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 226 297 3.0E-08
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 239 318 1.0E-07
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 239 318 1.0E-07
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 239 318 2.0E-07
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 239 318 2.0E-07
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 239 318 2.0E-07
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 239 369 3.0E-07
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 239 318 1.0E-06
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 239 360 3.0E-06
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 237 297 5.0E-06
sp|A8HAL1|UBP16_DANRE Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio GN=usp16 PE=3 SV=1 241 311 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|663500
MGRQIGGRLGRRNNPKEVLRRRRVIHIFRDAENKPSPEELKKPTTEPLPQDEDAGVTLGVLAIPSWMTSSDFLDF
IGPAVEGIAHLRLIRDSEPNRSIGLIRFTNPADAADFIEIYNGKQFNSLEPEICQVVHVLSVQIEPDDVLSQAIA
RMSSTYGPAYELPSCPVCLDRMDSAVTGLITVPCSHTFHCTCLSKWGDSRCPICRYSQNIMTSHLSSSANRLSRP
PPFSISSSSSPSTCSECPSVTNLWICLICGNIGCGRYGRAHAHAHYQATTHLYALELETQRVWDYAGDGYVHRLI
QNKADGKLVELPSAASSVGRGAPSREGGEGGLGPSQSDALTAEKIEAIGIEYSYLLTSQLDSQRAYYEEQNTQLQ
TQLAELKDAMEQMKVEREHQKMLEEENEARRQEEFAKVIEAAEKGKTKAEQRADRMRDLAKTLDKELKEERAVSE
GLMQNINSMKDRLNMAEVGQNESSEKIQELQEQVRDLMFFLEANTKIEQGGGVEAEAAGGSIEIRTDPHANSDAR
KKKGKGKKQ*
Coding >Agabi119p4|663500
ATGGGGCGACAGATAGGAGGCCGTTTGGGAAGGAGAAACAATCCAAAAGAGGTCCTGCGGAGGCGACGGGTCATT
CATATCTTTCGCGATGCTGAGAATAAACCATCACCTGAAGAATTGAAGAAGCCTACAACGGAACCGCTACCTCAG
GATGAGGATGCTGGAGTGACATTGGGTGTACTTGCAATACCCTCTTGGATGACTTCCTCGGATTTTCTTGATTTC
ATTGGCCCTGCCGTTGAGGGTATTGCGCACCTGCGTTTAATTCGAGATTCTGAGCCGAATCGATCTATTGGACTA
ATTCGATTCACAAATCCAGCTGACGCTGCAGACTTTATTGAGATATATAACGGAAAACAGTTCAATTCCTTGGAG
CCCGAAATATGCCAAGTCGTCCATGTCCTCTCGGTTCAAATTGAGCCAGATGATGTTTTATCTCAAGCCATTGCA
CGAATGAGCAGCACGTATGGACCTGCATACGAGCTTCCTTCGTGTCCTGTATGCCTAGATCGCATGGATTCTGCT
GTCACTGGCCTCATCACCGTCCCATGTTCGCATACATTCCATTGTACATGCTTGAGCAAGTGGGGAGATAGCCGA
TGTCCAATATGTCGTTATTCACAAAATATAATGACCTCGCATCTTTCTTCCTCAGCAAACCGACTATCACGTCCA
CCACCTTTCAGTATTTCGTCATCAAGCTCTCCATCTACTTGTTCTGAATGTCCTTCCGTCACGAATCTATGGATT
TGCCTTATATGCGGAAATATTGGATGTGGCCGGTATGGACGTGCGCATGCTCATGCGCACTATCAAGCGACAACA
CATTTATATGCGTTGGAGCTCGAGACGCAGAGGGTATGGGATTATGCTGGTGACGGATACGTCCACCGTCTCATT
CAAAATAAGGCAGATGGGAAATTAGTTGAACTCCCAAGTGCGGCTTCTTCTGTGGGCAGAGGAGCGCCTTCGAGA
GAAGGAGGAGAGGGAGGATTGGGACCAAGTCAAAGTGATGCTTTGACAGCTGAAAAAATCGAGGCGATTGGAATT
GAATACTCGTATCTCCTCACTTCGCAATTGGATTCCCAGCGCGCGTATTATGAAGAGCAGAATACTCAGCTTCAG
ACTCAGTTGGCGGAGTTGAAGGATGCCATGGAACAGATGAAAGTAGAGAGGGAACATCAGAAAATGTTGGAAGAG
GAGAATGAGGCGCGACGACAAGAGGAATTTGCGAAAGTAATAGAAGCAGCGGAGAAGGGCAAGACCAAGGCAGAA
CAGAGAGCAGATCGAATGAGGGATCTTGCGAAAACGTTGGATAAAGAGCTGAAGGAGGAGAGGGCTGTATCCGAG
GGGTTGATGCAAAATATCAACTCCATGAAAGACAGGTTGAATATGGCGGAGGTGGGGCAGAACGAATCTTCGGAG
AAAATTCAAGAACTACAGGAGCAAGTACGAGATTTGATGTTTTTCTTGGAAGCCAATACGAAGATTGAGCAGGGT
GGTGGTGTGGAGGCAGAGGCTGCTGGGGGTTCAATTGAAATCAGGACCGACCCTCATGCTAATTCTGATGCGAGG
AAGAAAAAGGGGAAAGGGAAGAAGCAATAA
Transcript >Agabi119p4|663500
ATGGGGCGACAGATAGGAGGCCGTTTGGGAAGGAGAAACAATCCAAAAGAGGTCCTGCGGAGGCGACGGGTCATT
CATATCTTTCGCGATGCTGAGAATAAACCATCACCTGAAGAATTGAAGAAGCCTACAACGGAACCGCTACCTCAG
GATGAGGATGCTGGAGTGACATTGGGTGTACTTGCAATACCCTCTTGGATGACTTCCTCGGATTTTCTTGATTTC
ATTGGCCCTGCCGTTGAGGGTATTGCGCACCTGCGTTTAATTCGAGATTCTGAGCCGAATCGATCTATTGGACTA
ATTCGATTCACAAATCCAGCTGACGCTGCAGACTTTATTGAGATATATAACGGAAAACAGTTCAATTCCTTGGAG
CCCGAAATATGCCAAGTCGTCCATGTCCTCTCGGTTCAAATTGAGCCAGATGATGTTTTATCTCAAGCCATTGCA
CGAATGAGCAGCACGTATGGACCTGCATACGAGCTTCCTTCGTGTCCTGTATGCCTAGATCGCATGGATTCTGCT
GTCACTGGCCTCATCACCGTCCCATGTTCGCATACATTCCATTGTACATGCTTGAGCAAGTGGGGAGATAGCCGA
TGTCCAATATGTCGTTATTCACAAAATATAATGACCTCGCATCTTTCTTCCTCAGCAAACCGACTATCACGTCCA
CCACCTTTCAGTATTTCGTCATCAAGCTCTCCATCTACTTGTTCTGAATGTCCTTCCGTCACGAATCTATGGATT
TGCCTTATATGCGGAAATATTGGATGTGGCCGGTATGGACGTGCGCATGCTCATGCGCACTATCAAGCGACAACA
CATTTATATGCGTTGGAGCTCGAGACGCAGAGGGTATGGGATTATGCTGGTGACGGATACGTCCACCGTCTCATT
CAAAATAAGGCAGATGGGAAATTAGTTGAACTCCCAAGTGCGGCTTCTTCTGTGGGCAGAGGAGCGCCTTCGAGA
GAAGGAGGAGAGGGAGGATTGGGACCAAGTCAAAGTGATGCTTTGACAGCTGAAAAAATCGAGGCGATTGGAATT
GAATACTCGTATCTCCTCACTTCGCAATTGGATTCCCAGCGCGCGTATTATGAAGAGCAGAATACTCAGCTTCAG
ACTCAGTTGGCGGAGTTGAAGGATGCCATGGAACAGATGAAAGTAGAGAGGGAACATCAGAAAATGTTGGAAGAG
GAGAATGAGGCGCGACGACAAGAGGAATTTGCGAAAGTAATAGAAGCAGCGGAGAAGGGCAAGACCAAGGCAGAA
CAGAGAGCAGATCGAATGAGGGATCTTGCGAAAACGTTGGATAAAGAGCTGAAGGAGGAGAGGGCTGTATCCGAG
GGGTTGATGCAAAATATCAACTCCATGAAAGACAGGTTGAATATGGCGGAGGTGGGGCAGAACGAATCTTCGGAG
AAAATTCAAGAACTACAGGAGCAAGTACGAGATTTGATGTTTTTCTTGGAAGCCAATACGAAGATTGAGCAGGGT
GGTGGTGTGGAGGCAGAGGCTGCTGGGGGTTCAATTGAAATCAGGACCGACCCTCATGCTAATTCTGATGCGAGG
AAGAAAAAGGGGAAAGGGAAGAAGCAATAA
Gene >Agabi119p4|663500
ATGGGGCGACAGATAGGAGGCCGTTTGGGAAGGAGAAACAATCCAAAAGAGGTAACAATCGAAAGAAAAACGTCC
AGGTTTTTATTGGATTATTAAACATTTTCAGGTCCTGCGGAGGCGACGTTTGTTTCTAAACCCCGTAGCAAGTTT
GGTAGTACTGATTTACCTGAAGGGGTCATTCATATCTTTCGCGATGCTGAGAATAAACCATCACCTGAAGAATTG
AAGAAGCCTACAACGGAACCGCTACCTCAGGATGAGGATGCTGGAGTGACATTGGGTGTACTTGCAATACCCTCT
TGGATGACTTCCTCGGATTTTCTTGATTTCATTGGCCCTGCCGTTGAGGGTATTGCGCACCTGCGTTTAATTCGG
TTTGTATTCCTTTTTAGGGCTTATCGAAGCTTAACCGCTCATTTCTCAGAGATTCTGAGCCGAATCGATCTATTG
GACTAATTCGATTCACAAATCCAGCTGACGCTGCAGACTTTATTGAGATATATAACGGAAAACAGTTCAATTCCT
TGGAGGTATATTGCTTACTGTTCGACCATGCTTGTTCGCTAATCGTTGTTACAATTTAGCCCGAAATATGCCAAG
TCGTCCATGTCCTCTCGGTTCAAATTGAGCCAGATGATGTTTTATCTCAAGCCATTGCACGAATGAGCAGCACGT
ATGGACCTGCATACGAGCTTCCTTCGTGTCCTGTATGCCTAGATCGCATGGATTCTGCTGTCACTGGCCTCATCA
CCGTCCCATGTTCGCATACATTCCATTGTACATGCTTGAGCAAGTGGGGAGATAGCCGGTAAGCGATTTCTGTTG
TCTTGTAAATCAAGTGTAACTGATTCTGTGAACAGATGTCCAATATGTCGTTATTCACAAAATATAATGACCTCG
CATCTTTCTTCCTCAGCAAACCGACTATCACGTCCACCACCTTTCAGTATTTCGTCATCAAGCTCTCCATCTACT
TGTTCTGAATGTCCTTCCGTCACGAATCTATGGATTTGCCTTATATGCGGAAATATTGGATGTGGCCGGTATGGA
CGTGCGCATGCTCATGCGCACTATCAAGCGACAACACATTTATATGCGTTGGAGCTCGAGACGCAGAGGGTATGG
GATTATGCTGGTGACGGATACGTCCACCGTCTCATTCAAAATAAGGCAGATGGGAAATTAGTTGAACTCCCAAGT
GCGGCTTCTTCTGTGGGCAGAGGAGCGCCTTCGAGAGAAGGAGGAGAGGGAGGATTGGGACCAAGTCAAAGTGAT
GCTTTGACAGCTGAAAAAATCGAGGCGATTGGAATTGAATACTCGTATCTCCTCACTTCGCAATTGGATTCCCAG
CGCGCGTATTATGAAGAGCAGAATACTCAGCTTCAGACTCAGTTGGCGGAGTTGAAGGATGCCATGGAACAGATG
AAAGTAGAGAGGGAACATCAGAAAATGTTGGAAGAGGAGAATGAGGCGCGACGACAAGAGGAATTTGCGAAAGTA
ATAGAAGCAGCGGAGAAGGGCAAGACCAAGGCAGAACAGAGAGCAGATCGAATGAGGGATCTTGCGAAAACGTTG
GATAAAGAGCTGAAGGAGGAGAGGGCTGTATCCGAGGGGTTGATGCAAAATATCAACTCCATGAAAGACAGGTTG
AATATGGCGGAGGTGGGGCAGAACGAATCTTCGGAGAAAATTCAAGAACTACAGGAGCAAGTACGAGATTTGATG
TTTTTCTTGGAAGCCAATACGAAGATTGAGCAGGGTGGTGGTGTGGAGGCAGAGGCTGCTGGGGGTTCAATTGAA
ATCAGGACCGACCCTCATGCTAATTCTGATGCGAGGAAGAAAAAGGGGAAAGGGAAGAAGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail