Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|663400
Gene name
Locationscaffold_06:1209881..1210544
Strand+
Gene length (bp)663
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12718 Tropomyosin_1 Tropomyosin like 2.2E-43 10 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40414|TPM2_YEAST Tropomyosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPM2 PE=1 SV=1 4 164 2.0E-22
sp|P17536|TPM1_YEAST Tropomyosin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPM1 PE=1 SV=1 4 164 7.0E-22
sp|Q02088|TPM_SCHPO Tropomyosin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc8 PE=3 SV=1 4 164 7.0E-21
sp|A1KYZ2|TPM_PENMO Tropomyosin OS=Penaeus monodon GN=TM1 PE=1 SV=1 4 130 1.0E-08
sp|P58775|TPM2_RAT Tropomyosin beta chain OS=Rattus norvegicus GN=Tpm2 PE=1 SV=1 4 130 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40414|TPM2_YEAST Tropomyosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPM2 PE=1 SV=1 4 164 2.0E-22
sp|P17536|TPM1_YEAST Tropomyosin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPM1 PE=1 SV=1 4 164 7.0E-22
sp|Q02088|TPM_SCHPO Tropomyosin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc8 PE=3 SV=1 4 164 7.0E-21
sp|A1KYZ2|TPM_PENMO Tropomyosin OS=Penaeus monodon GN=TM1 PE=1 SV=1 4 130 1.0E-08
sp|P58775|TPM2_RAT Tropomyosin beta chain OS=Rattus norvegicus GN=Tpm2 PE=1 SV=1 4 130 3.0E-08
sp|P58776|TPM2_RABIT Tropomyosin beta chain OS=Oryctolagus cuniculus GN=TPM2 PE=1 SV=1 4 130 3.0E-08
sp|P58774|TPM2_MOUSE Tropomyosin beta chain OS=Mus musculus GN=Tpm2 PE=1 SV=1 4 130 3.0E-08
sp|Q5KR48|TPM2_BOVIN Tropomyosin beta chain OS=Bos taurus GN=TPM2 PE=2 SV=1 4 130 3.0E-08
sp|P86704|TPM_PANBO Tropomyosin OS=Pandalus borealis GN=TM1 PE=1 SV=1 4 130 9.0E-08
sp|P07951|TPM2_HUMAN Tropomyosin beta chain OS=Homo sapiens GN=TPM2 PE=1 SV=1 4 130 2.0E-07
sp|Q01173|TPM1_XENLA Tropomyosin alpha-1 chain OS=Xenopus laevis GN=tpm1 PE=2 SV=1 4 130 2.0E-07
sp|Q5KR49|TPM1_BOVIN Tropomyosin alpha-1 chain OS=Bos taurus GN=TPM1 PE=2 SV=1 4 130 2.0E-07
sp|P04692|TPM1_RAT Tropomyosin alpha-1 chain OS=Rattus norvegicus GN=Tpm1 PE=1 SV=3 4 130 4.0E-07
sp|P58772|TPM1_RABIT Tropomyosin alpha-1 chain OS=Oryctolagus cuniculus GN=TPM1 PE=1 SV=1 4 130 4.0E-07
sp|P58771|TPM1_MOUSE Tropomyosin alpha-1 chain OS=Mus musculus GN=Tpm1 PE=1 SV=1 4 130 4.0E-07
sp|P42639|TPM1_PIG Tropomyosin alpha-1 chain OS=Sus scrofa GN=TPM1 PE=1 SV=2 4 130 5.0E-07
sp|P09493|TPM1_HUMAN Tropomyosin alpha-1 chain OS=Homo sapiens GN=TPM1 PE=1 SV=2 4 130 5.0E-07
sp|Q8WR63|TPM_TRIPS Tropomyosin OS=Trichinella pseudospiralis PE=2 SV=1 4 124 8.0E-07
sp|Q9N2R3|TPM_CHAFE Tropomyosin (Fragment) OS=Charybdis feriata PE=1 SV=1 4 130 1.0E-06
sp|P19352|TPM2_CHICK Tropomyosin beta chain OS=Gallus gallus GN=TPM2 PE=1 SV=1 4 130 1.0E-06
sp|P58773|TPM1_COTJA Tropomyosin alpha-1 chain OS=Coturnix coturnix japonica GN=TPM1 PE=2 SV=1 4 130 2.0E-06
sp|P04268|TPM1_CHICK Tropomyosin alpha-1 chain OS=Gallus gallus GN=TPM1 PE=1 SV=2 4 130 2.0E-06
sp|O44119|TPM_HOMAM Tropomyosin OS=Homarus americanus GN=TM1 PE=1 SV=1 4 130 2.0E-06
sp|Q9NFZ4|TPM_LEPDS Tropomyosin OS=Lepidoglyphus destructor PE=1 SV=1 4 130 2.0E-06
sp|A2V735|TPM_CHIOP Tropomyosin OS=Chionoecetes opilio GN=TM1 PE=1 SV=1 4 130 3.0E-06
sp|P13105|TPM1_RANTE Tropomyosin alpha-1 chain OS=Rana temporaria GN=tpm1 PE=2 SV=1 4 130 3.0E-06
sp|P13104|TPM1_DANRE Tropomyosin alpha-1 chain OS=Danio rerio GN=tpma PE=2 SV=1 4 130 4.0E-06
sp|Q23939|TPM_DERFA Tropomyosin OS=Dermatophagoides farinae PE=1 SV=2 4 130 4.0E-06
sp|Q9NDS0|TPM_BRABE Tropomyosin OS=Branchiostoma belcheri GN=TPM PE=2 SV=1 4 141 5.0E-06
sp|O18416|TPM_DERPT Tropomyosin OS=Dermatophagoides pteronyssinus PE=1 SV=1 4 130 6.0E-06
sp|Q07068|TPM1_CIOIN Tropomyosin, smooth muscle/fibroblast CTM1 OS=Ciona intestinalis GN=CTM1 PE=2 SV=1 4 124 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|663400
MAAMDRIREKLNGLRVEADNAIARAEESEAKNKKLEQELLHKEQEVKSLEHRLGLAESSLDKSEATVADLKKVVS
NSEGTGSTNDALTRKVELLEEELDASEKNLKETVEKLRQVDIKAEQLERQVQHLEQEKDMVEKKYEAEAEKYKKA
KADLDELVVSMEGL*
Coding >Agabi119p4|663400
ATGGCCGCCATGGACAGAATCAGAGAGAAACTCAATGGCCTTCGCGTCGAAGCCGATAACGCGATCGCGCGCGCT
GAAGAGTCCGAAGCGAAGAACAAGAAACTGGAACAAGAACTTCTTCACAAAGAACAAGAAGTAAAGTCCCTCGAG
CACCGTCTCGGACTCGCAGAATCTTCTCTCGACAAGAGCGAGGCCACCGTTGCCGATTTGAAGAAAGTAGTTTCC
AATTCCGAAGGCACAGGATCAACGAACGATGCCCTCACGAGAAAGGTTGAACTCTTGGAAGAAGAACTTGATGCT
TCCGAGAAGAACCTCAAGGAAACCGTTGAAAAGTTAAGACAAGTGGATATCAAGGCTGAACAACTAGAGCGACAA
GTGCAACATCTAGAGCAGGAGAAGGATATGGTAGAGAAGAAATACGAGGCGGAGGCAGAGAAATACAAGAAGGCC
AAGGCTGATCTTGATGAACTTGTTGTTTCTATGGAGGGCCTTTAA
Transcript >Agabi119p4|663400
ATGGCCGCCATGGACAGAATCAGAGAGAAACTCAATGGCCTTCGCGTCGAAGCCGATAACGCGATCGCGCGCGCT
GAAGAGTCCGAAGCGAAGAACAAGAAACTGGAACAAGAACTTCTTCACAAAGAACAAGAAGTAAAGTCCCTCGAG
CACCGTCTCGGACTCGCAGAATCTTCTCTCGACAAGAGCGAGGCCACCGTTGCCGATTTGAAGAAAGTAGTTTCC
AATTCCGAAGGCACAGGATCAACGAACGATGCCCTCACGAGAAAGGTTGAACTCTTGGAAGAAGAACTTGATGCT
TCCGAGAAGAACCTCAAGGAAACCGTTGAAAAGTTAAGACAAGTGGATATCAAGGCTGAACAACTAGAGCGACAA
GTGCAACATCTAGAGCAGGAGAAGGATATGGTAGAGAAGAAATACGAGGCGGAGGCAGAGAAATACAAGAAGGCC
AAGGCTGATCTTGATGAACTTGTTGTTTCTATGGAGGGCCTTTAA
Gene >Agabi119p4|663400
ATGGCCGCCATGGACAGAATCAGAGAGGTAATGCGTCTACCCATCCTCTTTTTTTTCGCTGTCCCTTCTGAGGCT
CCAATTACTTAGAAACTCAATGGCCTTCGCGTCGAAGCCGATAACGCGATCGCGCGCGCTGAAGAGTCCGAAGCG
AAGAACAAGAAACTGGAACAAGAACTTCTTCACAAAGAACAAGAAGTAAAGTCCCTCGAGCACCGTCTCGGACTC
GCAGAATCTTCTCTCGACAAGAGCGAGGCCACCGTTGCCGATTTGAAGAAAGTAGTTTCCAATTCCGAAGGCACA
GGATCAACGAACGATGCCCTCACGAGAAAGGTTGAACTCTTGGAAGAAGAACTTGATGCTTCCGAGAAGAACCTC
AAGGAAACCGTTGAAAAGTACGATTTCTCTCCACTTACGTGTCCTCGAATGCTAACCGCGCCTCTCCCAGGTTAA
GACAAGTGGATATCAAGGCTGAACAACTAGAGCGACAAGTGCAACATCTAGAGCAGGAGAAGGATATGGTAGAGA
AGAAATACGAGGTACGTTCAAAATCTAGTCTCATCAGCTTCCTTTCTGTACTCATATTCCCATCAGGCGGAGGCA
GAGAAATACAAGAAGGCCAAGGCTGATCTTGATGAACTTGTTGTTTCTATGGAGGGCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail