Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|661700
Gene name
Locationscaffold_06:765605..767304
Strand-
Gene length (bp)1699
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13424 TPR_12 Tetratricopeptide repeat 3.0E-07 40 83
PF10516 SHNi-TPR SHNi-TPR 4.5E-11 189 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ4|SIM3_SCHPO NASP-related protein sim3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sim3 PE=1 SV=1 29 381 2.0E-29
sp|P06180|HIBN_XENLA Histone-binding protein N1/N2 OS=Xenopus laevis PE=1 SV=3 157 277 3.0E-12
sp|Q02508|HGV2_HALRO Protein HGV2 OS=Halocynthia roretzi GN=HGV2 PE=2 SV=1 153 273 1.0E-11
sp|Q66HD3|NASP_RAT Nuclear autoantigenic sperm protein OS=Rattus norvegicus GN=Nasp PE=1 SV=1 148 273 2.0E-11
sp|Q2T9P4|NASP_BOVIN Nuclear autoantigenic sperm protein OS=Bos taurus GN=NASP PE=2 SV=2 148 269 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ4|SIM3_SCHPO NASP-related protein sim3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sim3 PE=1 SV=1 29 381 2.0E-29
sp|P06180|HIBN_XENLA Histone-binding protein N1/N2 OS=Xenopus laevis PE=1 SV=3 157 277 3.0E-12
sp|Q02508|HGV2_HALRO Protein HGV2 OS=Halocynthia roretzi GN=HGV2 PE=2 SV=1 153 273 1.0E-11
sp|Q66HD3|NASP_RAT Nuclear autoantigenic sperm protein OS=Rattus norvegicus GN=Nasp PE=1 SV=1 148 273 2.0E-11
sp|Q2T9P4|NASP_BOVIN Nuclear autoantigenic sperm protein OS=Bos taurus GN=NASP PE=2 SV=2 148 269 3.0E-11
sp|Q99MD9|NASP_MOUSE Nuclear autoantigenic sperm protein OS=Mus musculus GN=Nasp PE=1 SV=2 148 271 3.0E-11
sp|P27123|NASP_RABIT Nuclear autoantigenic sperm protein (Fragment) OS=Oryctolagus cuniculus GN=NASP PE=2 SV=2 149 269 5.0E-11
sp|P49321|NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens GN=NASP PE=1 SV=2 148 269 7.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|661700
MASNEMTTQTPPAPVSNAPNDEINAPTTLESALEQAKRAFALKKYEQAVDFYATALEFATKEHGDDSPLTADLYF
SYGRALLENAVSQSGVLGKGQPEAPVEEEPPVNSADGPILSFSGDAEEEDPAVDLFASAENAVVEEEKAAAAEEE
EDEPEDDFNAAWEVLDLARAIYDRQVQQDGDDEIRLKLADTYIALGDVSLETEKFDQAIQDYEAGLKHKVDLLPT
SSRQIAEAHYKLSMVLDLTSGRLSDAISHAENALESVEARLVELLHGLSGELPPLPEEPPTDSKGKGKAVTRLVR
DDVIQRMSSQRIEAEIKELTGLRDDLALKVEELKTSPNEILDQSAPALAAQALDKELNMEIKSAILPQVVNDLTG
IVKKKKKVATAETEASDSPSTEANGAKRKAEEEAEASSTEKKARLESS*
Coding >Agabi119p4|661700
ATGGCCTCAAACGAAATGACGACCCAAACACCACCGGCACCCGTATCAAACGCGCCAAACGATGAGATAAACGCA
CCAACGACGTTGGAAAGTGCTCTGGAACAGGCCAAACGCGCTTTTGCACTGAAGAAATATGAGCAGGCGGTGGAT
TTTTATGCTACGGCTTTGGAATTTGCGACGAAGGAACATGGAGATGATTCGCCACTGACTGCGGATTTGTATTTC
TCCTATGGGCGCGCCCTGCTTGAGAATGCGGTTTCTCAAAGTGGAGTACTTGGCAAAGGGCAGCCCGAGGCTCCT
GTGGAAGAGGAACCTCCAGTCAACTCTGCTGATGGACCAATTTTATCATTTTCGGGAGACGCAGAAGAGGAAGAT
CCTGCAGTTGACTTATTTGCAAGTGCAGAGAATGCTGTTGTAGAAGAAGAAAAGGCTGCTGCTGCGGAAGAAGAA
GAGGATGAACCTGAAGATGATTTTAATGCTGCTTGGGAAGTTCTGGACCTTGCTCGAGCTATTTATGATAGGCAG
GTGCAGCAGGATGGAGATGATGAAATAAGACTTAAATTGGCAGACACTTACATTGCCTTGGGCGATGTCTCGCTG
GAAACGGAAAAATTCGACCAGGCGATCCAAGATTATGAAGCGGGTCTCAAGCACAAAGTTGATCTCCTTCCAACA
TCCTCTCGTCAGATAGCCGAAGCGCACTATAAGCTTAGTATGGTGCTGGATCTTACCTCCGGGCGTCTATCAGAT
GCCATTTCTCATGCGGAAAATGCCCTCGAAAGTGTTGAGGCAAGGTTGGTAGAACTTCTGCATGGGTTGAGTGGT
GAACTGCCACCTCTTCCTGAAGAACCACCTACAGACTCGAAAGGCAAAGGAAAGGCTGTCACCAGGCTTGTAAGG
GACGATGTGATACAGCGGATGTCTAGTCAGCGGATAGAAGCCGAAATCAAGGAGTTGACAGGATTAAGGGATGAT
TTAGCTTTGAAGGTTGAAGAACTTAAGACGTCACCGAATGAAATTCTGGACCAGAGTGCACCTGCACTTGCGGCT
CAAGCTCTTGACAAAGAATTGAACATGGAGATAAAGTCCGCCATTTTGCCTCAGGTCGTGAACGACCTGACCGGT
ATCGTCAAAAAGAAAAAGAAAGTGGCAACAGCCGAAACCGAGGCCTCTGATAGCCCATCCACGGAAGCGAATGGT
GCAAAGAGAAAGGCAGAAGAGGAAGCGGAGGCGTCAAGTACGGAAAAGAAGGCCAGACTGGAGTCGTCATAA
Transcript >Agabi119p4|661700
ATGGCCTCAAACGAAATGACGACCCAAACACCACCGGCACCCGTATCAAACGCGCCAAACGATGAGATAAACGCA
CCAACGACGTTGGAAAGTGCTCTGGAACAGGCCAAACGCGCTTTTGCACTGAAGAAATATGAGCAGGCGGTGGAT
TTTTATGCTACGGCTTTGGAATTTGCGACGAAGGAACATGGAGATGATTCGCCACTGACTGCGGATTTGTATTTC
TCCTATGGGCGCGCCCTGCTTGAGAATGCGGTTTCTCAAAGTGGAGTACTTGGCAAAGGGCAGCCCGAGGCTCCT
GTGGAAGAGGAACCTCCAGTCAACTCTGCTGATGGACCAATTTTATCATTTTCGGGAGACGCAGAAGAGGAAGAT
CCTGCAGTTGACTTATTTGCAAGTGCAGAGAATGCTGTTGTAGAAGAAGAAAAGGCTGCTGCTGCGGAAGAAGAA
GAGGATGAACCTGAAGATGATTTTAATGCTGCTTGGGAAGTTCTGGACCTTGCTCGAGCTATTTATGATAGGCAG
GTGCAGCAGGATGGAGATGATGAAATAAGACTTAAATTGGCAGACACTTACATTGCCTTGGGCGATGTCTCGCTG
GAAACGGAAAAATTCGACCAGGCGATCCAAGATTATGAAGCGGGTCTCAAGCACAAAGTTGATCTCCTTCCAACA
TCCTCTCGTCAGATAGCCGAAGCGCACTATAAGCTTAGTATGGTGCTGGATCTTACCTCCGGGCGTCTATCAGAT
GCCATTTCTCATGCGGAAAATGCCCTCGAAAGTGTTGAGGCAAGGTTGGTAGAACTTCTGCATGGGTTGAGTGGT
GAACTGCCACCTCTTCCTGAAGAACCACCTACAGACTCGAAAGGCAAAGGAAAGGCTGTCACCAGGCTTGTAAGG
GACGATGTGATACAGCGGATGTCTAGTCAGCGGATAGAAGCCGAAATCAAGGAGTTGACAGGATTAAGGGATGAT
TTAGCTTTGAAGGTTGAAGAACTTAAGACGTCACCGAATGAAATTCTGGACCAGAGTGCACCTGCACTTGCGGCT
CAAGCTCTTGACAAAGAATTGAACATGGAGATAAAGTCCGCCATTTTGCCTCAGGTCGTGAACGACCTGACCGGT
ATCGTCAAAAAGAAAAAGAAAGTGGCAACAGCCGAAACCGAGGCCTCTGATAGCCCATCCACGGAAGCGAATGGT
GCAAAGAGAAAGGCAGAAGAGGAAGCGGAGGCGTCAAGTACGGAAAAGAAGGCCAGACTGGAGTCGTCATAA
Gene >Agabi119p4|661700
ATGGCCTCGTGCGTAATTCATTGTATTTCTACGATCGCGCTGTACACGAATGCTCTTGTCACAGAAACGAAATGA
CGACCCAAACACCACCGGCACCCGTATCAAACGCGCCAAACGATGAGATAAACGCACCAACGACGTTGGAAAGTG
CTCTGGAACAGGCCAAACGCGCTTTTGCACTGAAGAAATATGAGCAGGCGGTGGATTTTTATGCTACGGCTTTGG
AATTTGCGTGAGTTGCTTTTGTGAATCCATCCTTTTTTCTGCTTGCGTGAACGAGGTCAAAGGGCGTCATGCTAT
TGTTCCTTGCCACGGTATCGTGCAACTTTGACGCGTCCCAACTTCTTCCCTTCAATTTCTATCGTACGGGCATAT
CTTTTACACGTATGCTGACCCGAAATTCTGCGAATCTTCCAGGACGAAGGAACATGGAGATGATTCGCCACTGAC
TGCGGATTTGTATTTCTCCTATGGGCGCGCCCTGCTTGAGAATGCGGTTTCTCAAAGTGGAGTACTTGGCAAAGG
GCAGCCCGAGGCTCCTGTGGAAGAGGAACCTCCAGGTGCGTGTATTTTAGCTAACAGTCATCGTTTTCGCTAACT
TGAAGTCTCAAAATTGTTTCTGATTTCCGCAGTCAACTCTGCTGATGGACCAATTTTATCATTTTCGGGAGACGC
AGAAGAGGAAGATCCTGCAGTTGACTTATTTGCAAGTGCAGAGAATGCTGTTGTAGAAGAAGAAAAGGCTGCTGC
TGCGGAAGAAGAAGAGGATGAACCTGAAGATGATTTTAATGCTGCTTGGGAAGTTCTGGACCTTGCTCGAGCTAT
TTATGATAGGCAGGTGCAGCAGGATGGAGATGATGAAATAAGACTTAAATTGGCAGACACTTACATTGCCTTGGG
CGATGTCTCGCTGGAAACGGGTAGGTGATAAACTTTCCCCCTTACTTAATGTGCAATGACACTAAAAGGTTTGTA
TAGAAAAATTCGACCAGGCGATCCAAGATTATGAAGCGGGTCTCAAGCACAAAGTTGATCTCCTTCCAACATCCT
CTCGTCAGATAGCCGAAGCGCACTATAAGCTTAGTATGGTGCTGGATCTTACCTCCGGGCGTCTATCAGATGCCA
TTTCTCATGCGGAAAATGCCCTCGAAAGTGTTGAGGCAAGGTTGGTAGAACTTCTGCATGGGTTGAGTGGTGAAC
TGCCACCTCTTCCTGAAGAACCACCTACAGACTCGAAAGGCAAAGGAAAGGCTGTCACCAGGCTTGTAAGGGACG
ATGTGATACAGCGGATGTCTAGTCAGCGGATAGAAGCCGAAATCAAGGAGTTGACAGGATTAAGGGATGATTTAG
CTTTGAAGGTTAGTAAGAAACTGCAGTCGGCAGTTTACTATGTCTTTTCTAATTAGATTATTAGGTTGAAGAACT
TAAGACGTCACCGAATGAAATTCTGGACCAGAGTGCACCTGCACTTGCGGCTCAAGCTCTTGACAAAGAATTGAA
CATGGAGATAAAGTCCGCCATTTTGCCTCAGGTCGTGAACGACCTGACCGGTATCGTCAAAAAGAAAAAGAAAGT
GGCAACAGCCGAAACCGAGGCCTCTGATAGCCCATCCACGGAAGCGAATGGTGCAAAGAGAAAGGCAGAAGAGGA
AGCGGAGGCGTCAAGTACGGAAAAGAAGGCCAGACTGGAGTCGTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail