Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|661450
Gene name
Locationscaffold_06:752983..756108
Strand+
Gene length (bp)3125
Transcript length (bp)2388
Coding sequence length (bp)2388
Protein length (aa) 796

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01846 FF FF domain 4.5E-10 159 206
PF01846 FF FF domain 3.3E-13 371 425
PF00397 WW WW domain 3.9E-06 52 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14176|PRP40_SCHPO Pre-mRNA-processing protein prp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp40 PE=1 SV=1 11 592 3.0E-88
sp|P34600|YO61_CAEEL WW domain-containing protein ZK1098.1 OS=Caenorhabditis elegans GN=ZK1098.1 PE=1 SV=2 11 585 6.0E-42
sp|P33203|PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP40 PE=1 SV=1 8 609 5.0E-40
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 154 586 2.0E-37
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 154 586 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14176|PRP40_SCHPO Pre-mRNA-processing protein prp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp40 PE=1 SV=1 11 592 3.0E-88
sp|P34600|YO61_CAEEL WW domain-containing protein ZK1098.1 OS=Caenorhabditis elegans GN=ZK1098.1 PE=1 SV=2 11 585 6.0E-42
sp|P33203|PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP40 PE=1 SV=1 8 609 5.0E-40
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 154 586 2.0E-37
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 154 586 4.0E-37
sp|Q80W14|PR40B_MOUSE Pre-mRNA-processing factor 40 homolog B OS=Mus musculus GN=Prpf40b PE=1 SV=2 156 559 5.0E-35
sp|Q6NWY9|PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens GN=PRPF40B PE=1 SV=1 156 559 7.0E-34
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 11 595 3.0E-22
sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 157 672 3.0E-21
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 7 118 5.0E-20
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 10 79 3.0E-19
sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 7 146 5.0E-18
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 152 669 4.0E-17
sp|Q6NWY9|PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens GN=PRPF40B PE=1 SV=1 6 79 4.0E-16
sp|Q80W14|PR40B_MOUSE Pre-mRNA-processing factor 40 homolog B OS=Mus musculus GN=Prpf40b PE=1 SV=2 6 79 7.0E-16
sp|Q5HZF2|WBP4_RAT WW domain-binding protein 4 OS=Rattus norvegicus GN=Wbp4 PE=2 SV=1 11 80 4.0E-10
sp|Q61048|WBP4_MOUSE WW domain-binding protein 4 OS=Mus musculus GN=Wbp4 PE=1 SV=4 11 80 1.0E-09
sp|O75554|WBP4_HUMAN WW domain-binding protein 4 OS=Homo sapiens GN=WBP4 PE=1 SV=1 6 80 1.0E-09
sp|Q5F457|WBP4_CHICK WW domain-binding protein 4 OS=Gallus gallus GN=WBP4 PE=2 SV=1 11 84 4.0E-09
sp|Q9LT25|PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana GN=MED35C PE=1 SV=1 8 79 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|661450
MSACLPAMNIWTEHRNPEGRTYWFNTGTKQSVWEKPDELKSQFERALSKTKWKEYFSNGRKYYYNTETKESKWEM
PDDVILRVNLELLPLQDSHQSEEQLKSQQPNGTSNAGTPSLAVGPHTGNNGLPLAANSVLPARPHLPDDPVIPHN
GFATVEEGEKAFIHLLRKAGVDANWTWDQTMRAIITDPLYKALNTLAEKKSCWEKYTNGLRAKEQEEKEARLAKL
RPALRNMLKGNPNVFHYTTFRTADKLFAQHPIWQQARIEAERKLIFEEYVTELKQREMQESRGSRTRSVAKVVAL
FKELNVDVVTRWKTAHSMVMDSDEYKMDFELQKLPTLDILLAFEDYSRVREREYEEQTRRAQVEKTRKERKAREA
YKALLQELIDNEKIKARTKWKEVYPIFKDDDRYLNMLGNPGSNPLELFWDAVDTLDQKLHAKIVVVEEALRQWSP
PGSEAEKSKPEGDGDVKMGDTESGFVVSVDTKEEEFLKVVDAHATESSKQLSENDLHAVFNALKDVALKKQADEQ
RRAERKQRHLQDDLRYAMRKLAEPLDIALSYEEAVPLIAHLPEYKALEDEEGRRAAFAKFVKRQKERMREAASED
GASTTSRKRKEPHKEHKEEREGKEKNRDHDRDRERDREREKEKEKEKEKDRDYRERDRDRDRKDYDRRGSRHHRY
DDYDDRRARNYGRDRDREDRDRDGYRPSRHRDEDRRRDSGRKASRTDYYSRDWDATPKKERDRSTSVYQEEPAKE
KREWDGDSHDERIEKRPRIDREEGPNENMDVDKSARAESPEEGEI*
Coding >Agabi119p4|661450
ATGAGCGCTTGCCTACCCGCAATGAATATCTGGACTGAACATCGCAATCCTGAAGGGCGCACATATTGGTTCAAC
ACTGGCACGAAACAGAGCGTTTGGGAAAAACCTGACGAGCTCAAGTCGCAATTCGAGCGTGCGCTTAGTAAAACC
AAATGGAAGGAATATTTCTCCAACGGAAGAAAATACTATTACAACACCGAAACCAAGGAATCAAAATGGGAAATG
CCTGATGATGTTATACTGCGGGTCAACCTCGAGCTATTACCGCTCCAGGATTCACACCAGTCGGAGGAGCAACTC
AAGTCCCAACAACCCAACGGCACTAGTAATGCTGGAACACCTTCCCTTGCGGTCGGTCCCCACACAGGTAACAAC
GGTTTACCGCTTGCTGCGAATTCTGTTTTGCCAGCGCGGCCTCACTTGCCGGATGACCCCGTCATTCCACACAAC
GGGTTTGCTACGGTGGAGGAGGGCGAGAAAGCATTTATTCATTTGTTGAGAAAGGCAGGAGTGGATGCCAATTGG
ACGTGGGATCAAACGATGCGTGCCATTATTACTGATCCGTTGTACAAGGCTCTGAATACCCTCGCTGAGAAGAAA
AGTTGTTGGGAAAAGTATACAAACGGTTTGAGGGCGAAGGAGCAGGAAGAAAAAGAAGCTAGACTTGCTAAGCTA
CGCCCCGCTCTCCGGAATATGCTGAAAGGCAATCCGAACGTTTTTCATTATACGACATTTCGTACTGCAGACAAG
CTCTTTGCACAGCATCCCATATGGCAACAAGCTCGCATTGAAGCCGAAAGAAAACTCATATTTGAGGAGTATGTC
ACGGAATTAAAACAACGCGAAATGCAAGAATCTCGTGGTTCGCGCACGCGTAGTGTGGCCAAGGTGGTGGCGCTG
TTCAAAGAGCTGAATGTCGACGTTGTCACTCGCTGGAAAACTGCGCATAGTATGGTCATGGATTCTGATGAATAC
AAGATGGACTTTGAATTGCAGAAATTACCTACCTTGGATATCTTGTTGGCGTTTGAAGACTATAGTCGAGTAAGA
GAGAGGGAGTACGAAGAACAGACAAGGAGGGCACAGGTAGAAAAAACCAGAAAAGAGAGGAAGGCTAGAGAAGCG
TACAAGGCACTTTTGCAAGAGCTTATTGACAACGAGAAAATCAAAGCGAGAACAAAGTGGAAAGAAGTATATCCC
ATCTTCAAGGATGATGATCGGTATCTCAACATGCTTGGCAATCCTGGTTCTAACCCGCTGGAATTGTTCTGGGAT
GCTGTTGATACGCTTGACCAGAAATTGCATGCTAAGATTGTTGTTGTTGAAGAAGCTTTGCGTCAATGGAGCCCT
CCTGGATCTGAAGCTGAAAAGTCAAAGCCCGAGGGTGATGGTGATGTGAAGATGGGTGATACAGAGAGCGGGTTT
GTGGTGTCAGTCGACACTAAAGAAGAAGAATTTTTGAAGGTCGTTGACGCTCATGCTACAGAATCTTCGAAGCAG
TTGAGCGAAAATGATTTGCATGCGGTTTTCAATGCTCTTAAGGATGTTGCGCTGAAAAAACAAGCGGATGAACAG
AGACGAGCAGAAAGAAAACAAAGACATCTACAAGATGATTTAAGGTATGCAATGAGGAAGCTTGCTGAACCACTT
GATATCGCTCTTTCCTACGAAGAGGCAGTTCCTTTGATTGCGCATTTGCCAGAGTACAAAGCTCTTGAAGACGAG
GAAGGGCGTCGCGCTGCATTTGCCAAATTCGTCAAACGACAAAAGGAACGTATGCGTGAAGCTGCCTCGGAAGAT
GGCGCGTCGACGACGAGTAGAAAGAGAAAGGAACCTCACAAAGAGCATAAAGAGGAGCGAGAGGGGAAGGAAAAG
AACAGAGACCACGATAGGGACCGGGAGCGTGATAGGGAGAGGGAAAAAGAGAAAGAAAAAGAAAAAGAAAAGGAT
CGAGATTACCGTGAGCGAGACAGGGATAGAGACAGAAAGGATTATGACCGACGAGGCTCGAGGCATCACCGGTAT
GATGATTACGATGATCGGAGAGCTAGGAACTATGGAAGGGATCGTGATCGAGAGGACCGGGATAGGGATGGCTAC
AGACCTTCTCGTCACAGGGACGAAGACAGGAGGCGCGACAGTGGACGTAAAGCTTCACGAACTGATTATTACTCA
AGAGACTGGGATGCGACTCCCAAGAAGGAACGAGATAGGAGCACGTCTGTGTACCAGGAGGAGCCTGCCAAAGAA
AAGAGAGAATGGGACGGAGACAGTCACGACGAAAGGATTGAAAAGCGGCCTCGGATTGATCGTGAAGAGGGACCC
AACGAAAACATGGATGTTGACAAGTCTGCGCGTGCTGAGAGCCCCGAGGAAGGCGAGATTTGA
Transcript >Agabi119p4|661450
ATGAGCGCTTGCCTACCCGCAATGAATATCTGGACTGAACATCGCAATCCTGAAGGGCGCACATATTGGTTCAAC
ACTGGCACGAAACAGAGCGTTTGGGAAAAACCTGACGAGCTCAAGTCGCAATTCGAGCGTGCGCTTAGTAAAACC
AAATGGAAGGAATATTTCTCCAACGGAAGAAAATACTATTACAACACCGAAACCAAGGAATCAAAATGGGAAATG
CCTGATGATGTTATACTGCGGGTCAACCTCGAGCTATTACCGCTCCAGGATTCACACCAGTCGGAGGAGCAACTC
AAGTCCCAACAACCCAACGGCACTAGTAATGCTGGAACACCTTCCCTTGCGGTCGGTCCCCACACAGGTAACAAC
GGTTTACCGCTTGCTGCGAATTCTGTTTTGCCAGCGCGGCCTCACTTGCCGGATGACCCCGTCATTCCACACAAC
GGGTTTGCTACGGTGGAGGAGGGCGAGAAAGCATTTATTCATTTGTTGAGAAAGGCAGGAGTGGATGCCAATTGG
ACGTGGGATCAAACGATGCGTGCCATTATTACTGATCCGTTGTACAAGGCTCTGAATACCCTCGCTGAGAAGAAA
AGTTGTTGGGAAAAGTATACAAACGGTTTGAGGGCGAAGGAGCAGGAAGAAAAAGAAGCTAGACTTGCTAAGCTA
CGCCCCGCTCTCCGGAATATGCTGAAAGGCAATCCGAACGTTTTTCATTATACGACATTTCGTACTGCAGACAAG
CTCTTTGCACAGCATCCCATATGGCAACAAGCTCGCATTGAAGCCGAAAGAAAACTCATATTTGAGGAGTATGTC
ACGGAATTAAAACAACGCGAAATGCAAGAATCTCGTGGTTCGCGCACGCGTAGTGTGGCCAAGGTGGTGGCGCTG
TTCAAAGAGCTGAATGTCGACGTTGTCACTCGCTGGAAAACTGCGCATAGTATGGTCATGGATTCTGATGAATAC
AAGATGGACTTTGAATTGCAGAAATTACCTACCTTGGATATCTTGTTGGCGTTTGAAGACTATAGTCGAGTAAGA
GAGAGGGAGTACGAAGAACAGACAAGGAGGGCACAGGTAGAAAAAACCAGAAAAGAGAGGAAGGCTAGAGAAGCG
TACAAGGCACTTTTGCAAGAGCTTATTGACAACGAGAAAATCAAAGCGAGAACAAAGTGGAAAGAAGTATATCCC
ATCTTCAAGGATGATGATCGGTATCTCAACATGCTTGGCAATCCTGGTTCTAACCCGCTGGAATTGTTCTGGGAT
GCTGTTGATACGCTTGACCAGAAATTGCATGCTAAGATTGTTGTTGTTGAAGAAGCTTTGCGTCAATGGAGCCCT
CCTGGATCTGAAGCTGAAAAGTCAAAGCCCGAGGGTGATGGTGATGTGAAGATGGGTGATACAGAGAGCGGGTTT
GTGGTGTCAGTCGACACTAAAGAAGAAGAATTTTTGAAGGTCGTTGACGCTCATGCTACAGAATCTTCGAAGCAG
TTGAGCGAAAATGATTTGCATGCGGTTTTCAATGCTCTTAAGGATGTTGCGCTGAAAAAACAAGCGGATGAACAG
AGACGAGCAGAAAGAAAACAAAGACATCTACAAGATGATTTAAGGTATGCAATGAGGAAGCTTGCTGAACCACTT
GATATCGCTCTTTCCTACGAAGAGGCAGTTCCTTTGATTGCGCATTTGCCAGAGTACAAAGCTCTTGAAGACGAG
GAAGGGCGTCGCGCTGCATTTGCCAAATTCGTCAAACGACAAAAGGAACGTATGCGTGAAGCTGCCTCGGAAGAT
GGCGCGTCGACGACGAGTAGAAAGAGAAAGGAACCTCACAAAGAGCATAAAGAGGAGCGAGAGGGGAAGGAAAAG
AACAGAGACCACGATAGGGACCGGGAGCGTGATAGGGAGAGGGAAAAAGAGAAAGAAAAAGAAAAAGAAAAGGAT
CGAGATTACCGTGAGCGAGACAGGGATAGAGACAGAAAGGATTATGACCGACGAGGCTCGAGGCATCACCGGTAT
GATGATTACGATGATCGGAGAGCTAGGAACTATGGAAGGGATCGTGATCGAGAGGACCGGGATAGGGATGGCTAC
AGACCTTCTCGTCACAGGGACGAAGACAGGAGGCGCGACAGTGGACGTAAAGCTTCACGAACTGATTATTACTCA
AGAGACTGGGATGCGACTCCCAAGAAGGAACGAGATAGGAGCACGTCTGTGTACCAGGAGGAGCCTGCCAAAGAA
AAGAGAGAATGGGACGGAGACAGTCACGACGAAAGGATTGAAAAGCGGCCTCGGATTGATCGTGAAGAGGGACCC
AACGAAAACATGGATGTTGACAAGTCTGCGCGTGCTGAGAGCCCCGAGGAAGGCGAGATTTGA
Gene >Agabi119p4|661450
ATGAGCGCTTGCCTACCCGCAATGAATATCTGGGTGAGTACAGTCTTGAAAGGCTAGGACTAAGCTAATCTTTTC
ATCCAGACTGAACATCGCAATCCTGAAGGGCGCACATATTGGTTCAACACTGGCACGAAACAGAGCGTTTGGGAA
AAACCTGACGGTGAGCACTGGTTTCTTCATATTCCATCGCGTATTTTTTCAACTATATTTTTACAGAGCTCAAGT
CGCAATTCGAGGTCAGCACATCATCATGGCTTGTTGTATCGCGCTTCTCATAAACTTCTCTCTATAGCGTGCGCT
TAGTAAAACCAAATGGAAGGAATATTTCTCCAACGGAAGAAAATACTATTACAACGTATACAAGTCTCGTCATCA
TTCAAATAAGCAAATACTAATATGTGCTTTCAGACCGAAACCAAGGAATCAAAATGGGAAATGCCTGATGATGTT
ATAGTGTACCTCGACCAAGTGCAAGAAGAGTTGAAAACTAGTACTCCTGGGCAACCAGCTGCGGGGTATTTATGT
TTCTCATGTTCCATTCTCATTTCATTGATAATGTACGCGCTAGTCAACCTCGAGCTATTACCGCTCCAGGATTCA
CACCAGTCGGAGGAGCAACTCAAGGTGCACTCGTCCCCATGGGAGGCGCTGACATTTCCTCATCTACTCCCTCAT
CCCAGTCCCAACAACCCAACGGCACTAGTAATGCTGGAACACCTTCCCTTGCGGTCGGTCCCCACACAGGTAACA
ACGGTTTACCGCTTGCTGCGAATTCTGTTTTGCCAGCGCGGCCTCACTTGCCGGATGACCCCGTCATTCCACACA
ACGGGTTTGCTACGGTGGAGGAGGGCGAGAAAGCATTTATTCATTTGTTGAGAAAGGCAGGAGTGGATGCCAATT
GGACGTGGGATCAAACGATGCGTGCCATTATTACTGATCCGTTGTACAAGGCTCTGAATACCCTCGCTGAGAAGA
AAAGTTGTTGGGAAAAGGTATGATAATATCGCGTTCATTTGGGAAATTGACGCTGAATTTGTTTGATAGTATACA
AACGGTTTGAGGGCGAAGGAGCAGGAAGAAAAAGAAGCTAGACTTGCTAAGCTACGCCCCGCTCTCCGGAATATG
CTGAAAGGCAATCCGAACGTTTTTCATTATACGACATTTCGTACTGCAGACAAGCTCTTTGCACAGCATCCCATA
TGGCAACAAGCTCGCATTGAAGCCGAAAGAAAACTCATATTTGAGGAGTATGTCACGGAATTAAAACAACGCGAA
ATGGTGGGTAGTAATTTCTATTTCCATAGCTTAATCTTCATCACGCGTTATATTATAGCAAGAATCTCGTGGTTC
GCGCACGCGTAGTGTGGCCAAGGTGGTGGCGCTGTTCAAAGAGCTGAATGTCGACGTTGTCACTCGCTGGAAAAC
TGCGCATAGTATGGTCATGGATTCTGATGAATACAAGATGGACTTTGAATTGCAGAAATTACCTACCTTGGATAT
CTTGTTGGCGTTTGAAGACTATAGTCGAGTAAGAGAGAGGGAGTACGAAGAACAGACAAGGAGGGCACAGGTAGA
AAAAACCAGAAAAGAGAGGAAGGCTAGAGAAGCGTACAAGGTTTGTCTCGCTTAAGTTGTATTATTTGCTATGGT
TAACGGGCTCCCTAGGCACTTTTGCAAGAGCTTATTGACAACGAGAAAATCAAAGCGAGAACAAAGTGGAAAGAA
GTATATCCCATCTTCAAGGATGATGATCGGTATCTCAACATGCTTGGCAATCCTGGTTCTAACCCGCTGGAATTG
TTCTGGGATGCTGTTGATACGCTTGACCAGAAATTGCATGCTAAGATTGTTGTTGTTGAAGAAGCTTTGCGTCAA
TGGAGCCCTCCTGGATCTGAAGCTGAAAAGTCAAAGCCCGAGGGTGATGGTGATGTGAAGATGGGTGATACAGAG
AGCGGGTTTGTGGTGTCAGTCGACACTAAAGAAGAAGAATTTTTGAAGGTCGTTGACGCTCATGCTACAGAATCT
TCGAAGCAGTTGAGCGAAAATGATTTGCATGCGGTTTTCAATGCTGTACGTGTTTTGGTATATTTTTGAGCTCTG
TCGTTGATCCATTTTGTAGCTTAAGGATGTTGCGCTGAAAAAACAAGCGGATGAACAGAGACGAGCAGAAAGAAA
ACAAAGACATCTACAAGATGATTTAAGGTATGCAATGAGGAAGCTTGCTGAACCACTTGATATCGCTCTTTCCTA
CGAAGAGGTGAGTCGTTGGCTTCGCTTTTTTTCGCTAGTTTTTTTTTTGACAGTCATAAAGGCAGTTCCTTTGAT
TGCGCATTTGCCAGAGTACAAAGCTCTTGAAGACGAGGAAGGGCGTCGCGCTGCATTTGCCAAATTCGTCAAACG
ACAAAAGGTAGTTCTGCAGTGTGGAAAATGACTTAGAAGCTAATCTTGGTTATAGGAACGTATGCGTGAAGCTGC
CTCGGAAGATGGCGCGTCGACGACGAGTAGAAAGAGAAAGGAACCTCACAAAGAGCATAAAGAGGAGCGAGAGGG
GAAGGAAAAGAACAGAGACCACGATAGGGACCGGGAGCGTGATAGGGAGAGGGAAAAAGAGAAAGAAAAAGAAAA
AGAAAAGGATCGAGATTACCGTGAGCGAGACAGGGATAGAGACAGAAAGGATTATGACCGACGAGGCTCGAGGCA
TCACCGGTATGATGATTACGATGATCGGAGAGCTAGGAACTATGGAAGGGATCGTGATCGAGAGGACCGGGATAG
GGATGGCTACAGACCTTCTCGTCACAGGGACGAAGACAGGAGGCGCGACAGTGGACGTAAAGCTTCACGAACTGA
TTATTACTCAAGAGACTGGGATGCGACTCCCAAGAAGGAACGAGATAGGAGCACGTCTGTGTACCAGGAGGAGCC
TGCCAAAGAAAAGAGAGAATGGGACGGAGACAGTCACGACGAAAGGATTGAAAAGGTACAGTATTGAATGTGTTT
TACGCGAGAAAATTACTCAAGTCTTGTTGTAGCGGCCTCGGATTGATCGTGAAGAGGGACCCAACGAAAACATGG
ATGTTGACAAGTCTGCGCGTGCTGAGAGCCCCGAGGAAGGCGAGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail