Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|660500
Gene name
Locationscaffold_06:534304..535708
Strand+
Gene length (bp)1404
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 2.6E-24 103 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 137 274 8.0E-18
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 137 274 8.0E-18
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 11 256 1.0E-16
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 14 274 6.0E-16
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 91 278 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 137 274 8.0E-18
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 137 274 8.0E-18
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 11 256 1.0E-16
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 14 274 6.0E-16
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 91 278 5.0E-13
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 91 278 5.0E-13
sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=3 SV=2 101 267 5.0E-12
sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 101 267 5.0E-12
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 118 251 2.0E-09
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 118 251 4.0E-09
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 118 251 1.0E-08
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 118 251 2.0E-08
sp|Q3EBR6|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic OS=Arabidopsis thaliana GN=At2g30550 PE=1 SV=2 101 254 2.0E-08
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 118 251 2.0E-08
sp|Q8S1D9|EG1_ORYSJ Phospholipase A1 EG1, chloroplastic OS=Oryza sativa subsp. japonica GN=EG1 PE=1 SV=1 73 243 6.0E-08
sp|A2WY00|EG1_ORYSI Phospholipase A1 EG1, chloroplastic OS=Oryza sativa subsp. indica GN=EG1 PE=3 SV=1 73 243 6.0E-08
sp|Q941F1|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic OS=Arabidopsis thaliana GN=At1g06800 PE=1 SV=2 101 250 1.0E-07
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 140 251 3.0E-07
sp|Q6F358|PLA6_ORYSJ Phospholipase A1-II 6 OS=Oryza sativa subsp. japonica GN=Os05g0574000 PE=2 SV=1 101 268 1.0E-06
sp|A2WTA0|PLA3_ORYSI Phospholipase A1-II 3 OS=Oryza sativa subsp. indica GN=OsI_03088 PE=3 SV=1 101 265 5.0E-06
sp|Q8RZ40|PLA3_ORYSJ Phospholipase A1-II 3 OS=Oryza sativa subsp. japonica GN=Os01g0651800 PE=2 SV=1 101 265 5.0E-06
sp|Q9SIN9|PLA13_ARATH Phospholipase A1-Ialpha2, chloroplastic OS=Arabidopsis thaliana GN=At2g31690 PE=1 SV=1 101 240 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|660500
MAYPLLRFATFLLGASTAVIAAPASLVQRQSFSTLAAADIARFKPFTFFASSAYCSPKLTKTWTCGANCDANPNF
QPTASGGDGIDVQFWYVGFDPDLSTIIVAHQGTDPSKIEPLLTDADIFLQNLDSNLFPGLPKDIKVHSGFADSQK
ETAKDVLAAVRQTMQDHNTTKVTVASHSLGSAIALLDAISLPLLIPGIDLEMFSYAMPRVGNQEFADYVDANLKL
TRITNKKDLVPILPGRFLGFHHPSSEIHIQSDDGSFVSCPGQDNTDKRCIVGDTKNIFRARLEDHGGPYDGVRIG
C*
Coding >Agabi119p4|660500
ATGGCCTACCCACTCCTTCGATTCGCCACCTTTCTACTTGGAGCAAGCACTGCTGTTATTGCAGCGCCAGCTTCG
CTAGTTCAACGACAATCATTTTCGACACTTGCAGCAGCAGACATAGCCAGATTCAAACCATTCACCTTTTTCGCT
AGCAGTGCGTATTGTTCGCCGAAACTGACCAAGACGTGGACTTGCGGAGCCAACTGCGATGCCAATCCGAATTTT
CAGCCTACAGCATCAGGTGGTGATGGTATCGATGTACAATTCTGGTATGTTGGGTTTGATCCTGATTTAAGTACT
ATCATTGTTGCTCATCAAGGAACTGATCCATCAAAAATCGAACCACTCCTGACGGACGCGGATATATTTCTACAA
AACCTTGATTCAAATCTATTCCCCGGCCTACCGAAAGATATCAAAGTGCATAGTGGATTTGCCGACTCTCAAAAA
GAGACGGCAAAAGATGTCCTCGCTGCGGTTCGGCAAACAATGCAAGACCATAATACAACTAAAGTCACTGTTGCT
AGCCATTCACTAGGTAGTGCGATTGCTCTCCTCGATGCTATATCTCTTCCTCTTCTTATTCCTGGAATCGACCTC
GAAATGTTTAGTTACGCTATGCCACGTGTTGGGAATCAAGAATTTGCGGATTACGTAGATGCAAACCTGAAATTG
ACTCGTATCACAAACAAAAAGGATCTCGTGCCGATTTTGCCTGGGAGGTTCCTTGGTTTCCACCACCCGTCAAGT
GAAATTCACATTCAAAGCGATGATGGGTCTTTCGTTTCGTGTCCGGGACAAGATAACACAGATAAACGATGTATT
GTTGGAGATACAAAGAACATTTTTAGGGCTCGATTGGAAGATCATGGTGGCCCTTATGATGGAGTGCGTATTGGT
TGTTGA
Transcript >Agabi119p4|660500
ATGGCCTACCCACTCCTTCGATTCGCCACCTTTCTACTTGGAGCAAGCACTGCTGTTATTGCAGCGCCAGCTTCG
CTAGTTCAACGACAATCATTTTCGACACTTGCAGCAGCAGACATAGCCAGATTCAAACCATTCACCTTTTTCGCT
AGCAGTGCGTATTGTTCGCCGAAACTGACCAAGACGTGGACTTGCGGAGCCAACTGCGATGCCAATCCGAATTTT
CAGCCTACAGCATCAGGTGGTGATGGTATCGATGTACAATTCTGGTATGTTGGGTTTGATCCTGATTTAAGTACT
ATCATTGTTGCTCATCAAGGAACTGATCCATCAAAAATCGAACCACTCCTGACGGACGCGGATATATTTCTACAA
AACCTTGATTCAAATCTATTCCCCGGCCTACCGAAAGATATCAAAGTGCATAGTGGATTTGCCGACTCTCAAAAA
GAGACGGCAAAAGATGTCCTCGCTGCGGTTCGGCAAACAATGCAAGACCATAATACAACTAAAGTCACTGTTGCT
AGCCATTCACTAGGTAGTGCGATTGCTCTCCTCGATGCTATATCTCTTCCTCTTCTTATTCCTGGAATCGACCTC
GAAATGTTTAGTTACGCTATGCCACGTGTTGGGAATCAAGAATTTGCGGATTACGTAGATGCAAACCTGAAATTG
ACTCGTATCACAAACAAAAAGGATCTCGTGCCGATTTTGCCTGGGAGGTTCCTTGGTTTCCACCACCCGTCAAGT
GAAATTCACATTCAAAGCGATGATGGGTCTTTCGTTTCGTGTCCGGGACAAGATAACACAGATAAACGATGTATT
GTTGGAGATACAAAGAACATTTTTAGGGCTCGATTGGAAGATCATGGTGGCCCTTATGATGGAGTGCGTATTGGT
TGTTGA
Gene >Agabi119p4|660500
ATGGCCTACCCACTCCTTCGATTCGCCACCTTTCTACTTGGAGCAAGCACTGCTGTTATTGCAGCGCCAGCTTCG
CTAGTTCAACGACAATCATTTTCGACACTTGCAGCAGCAGACATAGCCAGATTCAAACCATTCACCTTTTTCGCT
AGCAGTGCGTATTGTTCGCCGAAACTGACCAAGACGTGGACTTGCGGAGGTAAGGATTCCATACATAAGTTTGTT
GTATACATACACACTCACCCTACACCTTGAAAAAATTTATCCCTAATAGCCAACTGCGATGCCAATCCGAATTTT
CAGCCTACAGCATCAGGTGGTGATGGTATCGATGTACAATTCTGGTATGTTGGGTTTGATCCTGATTTAAGTGTA
TGTTGTCTATGAATATTGTTTCGTTATTATCTTTTTTGCTGATTTCATACCGAGAATTTAGACTATCATTGTTGC
TCATCAAGGAACTGATCCATCAAAAATGTGCGTAACAAAATAAAAAAACTGAGATACGATTTTTTTTAACAGTCA
ACGGTTATTCTAGCGAACCACTCCTGACGGACGCGGATATATTTCTACAAAACCTTGATTCAAATCTATTCCCCG
GCCTACCGAAAGATATCAAAGTGCATAGTGGATTTGCCGACTCTCAAAAAGAGTACGTTCATTATCATTACTCTG
TAAATACTCGCTTAATAATTATCTTTGACAGGACGGCAAAAGATGTCCTCGCTGCGGTTCGGCAAACAATGCAAG
ACCATAATACAACTAAAGTCACTGTTGCTAGCCATTCACTAGGTACGAATACATTCCAATTTTTTTGAGCTTTAT
TGGTTAATTTCAATATCAATGAATTGAAGGTAGTGCGATTGCTCTCCTCGATGCTATATCTCTTCCTCTTCTTAT
TCCTGGAATCGACCTCGAAATGTTTAGTTACGCTATGCCACGTGTAAGTCGAGTCGTGTTCACAAAGGACAGGCG
GTTTTGAGAAACATAATTTAATAGGTTGGGAATCAAGAATTTGCGGATTACGTAGATGCAAACCTGAAATTGACT
CGTATCACAAACAAGTAAGCTCTTCTTTCTTACAATTTTGATTTGAACAGGCTTTTGAATTGTATGTACAGAAAG
GATCTCGTGCCGATTTTGCCTGGGAGGTTCCTTGGTTTCCACCACCCGTCAAGTGAAATTCACATTCAAAGCGAT
GATGGGTCTTTCGTTTCGTGTCCGGGACAAGATAACACAGATAAACGATGTATTGTTGGAGATACAAAGAACATT
TTTAGGGCTCGATTGGAAGATCATGGTGGTACGCATTTTTGTATCCTTGAATAATTTATTTTGTTGTATTGAATT
TTTTGCTCTCGTTTTATTTCAGGCCCTTATGATGGAGTGCGTATTGGTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail