Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|659750
Gene name
Locationscaffold_06:402384..407384
Strand-
Gene length (bp)5000
Transcript length (bp)4317
Coding sequence length (bp)4317
Protein length (aa) 1439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 3.3E-05 830 950
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 4.5E-07 257 286
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.2E-07 49 125
PF13637 Ank_4 Ankyrin repeats (many copies) 3.5E-07 58 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 51 572 5.0E-67
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 51 375 4.0E-36
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 54 383 1.0E-33
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 54 383 3.0E-26
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 136 447 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 51 572 5.0E-67
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 51 375 4.0E-36
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 54 383 1.0E-33
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 54 383 3.0E-26
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 136 447 2.0E-12
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 154 455 6.0E-12
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 154 455 6.0E-12
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 154 454 3.0E-11
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 154 454 9.0E-11
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 153 343 3.0E-10
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 121 447 4.0E-10
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 155 456 6.0E-10
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 153 366 6.0E-10
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 153 348 8.0E-10
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 764 992 1.0E-09
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 153 366 1.0E-09
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 224 484 1.0E-08
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 147 343 1.0E-08
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 156 392 3.0E-08
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 154 374 7.0E-08
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 153 381 2.0E-07
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 153 350 3.0E-07
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 153 350 4.0E-07
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 155 350 4.0E-07
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 214 348 5.0E-07
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 153 366 1.0E-06
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 153 348 1.0E-06
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 140 366 1.0E-06
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 155 366 2.0E-06
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 153 348 3.0E-06
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 155 350 3.0E-06
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 153 348 6.0E-06
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 206 347 7.0E-06
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 157 348 7.0E-06
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 214 447 9.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 153 349 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|659750
MSLLHDAFNARNLHLFQRLVDTSNAADKSASVSSTSVGKVSKHSSLGNIDVNQRDWLGRTVLHLASAAIEHLDYV
RILLKHPAISVNAADTESHWTPLHRSLYSANLPAARLLLQRPDIDIFLKDNEGYTAFDLYNSTLVGTKPSPEETG
GYADLYTWGTNVNAALGLGDSNDRAYPELVVFPRREDEADLERQTLSARFLPIKAEHVEMSKLHTVVSTSETGGN
LRVCGFGSGGRLGPNSHTQYLLKSLSQLTQVITAIALGQDHTLALTKAGEVLSWGLNRFSQLGYPVDPPTSGRLE
EPIQYSPRRVQGPLKKEVVKGVAASKVASACWTDDSVYTWGTNNGQLGYDKAAQPVQVQPRKVSRLTVSVISIVM
SENVMACLMQNRQVECFYDDGHHRINFPTLAFPSPIRPYRPPQAAKDSRMAKITCCGDVFAALTSHGEVYIFSPS
SSHSANSIPSSSSSANLSTSFNDSEVPTRMGGPFKCQRVWALRKKFSAVKDVALGADGSIIICTESGHVYVRTRN
VKMSSVGGSGSSSSQKAFKFVKVPGLQRVTRVCASASGAFGALRVEYRMKNVEVKGNFVAQDLSRVRPWLESGKD
DASLDTRVMESDDEGEDSGRDKEENAISFFGYGHESDNEDAEGRGEDDAIVNDIRFLKEMCDAIKREDKRKKDGR
RLEHMHLRHGADTLLVLSSFNIVFPVHRAILGARSKVLCGISRSAFYRLYNDILPILSRYADRDPTRISTSIINS
YAKGLKIKMDPGLIKNELQVLGRMLDLSEMLKVLERPVKSDVRPTLVRDLSELFDIVNLERDDDDDEGGVEKVPR
ALCEDVILELADREVFTHSVILRSRSNLFKSFFDEPVWTLNRWETEGIDYVEGEHGILRIDLKHLKWRVMEFVLK
FMCCGCDKELFERAEFIDGVDDLVEFMFEVMAAANELLVDRLVLLCSEVILTYTSLHNACYVLYLATYYSATQLI
DRVQSFITANMELFLQSYMLDDIPLDLLTQLSNYAQEKQKEKAPFVRGGVLEEGVMEKWRKWVEDLDVPIPIVRS
NKPWKEKKGLPLPDFGKDKRGGREKGLRRPPSGDDIFIMDDTDLLSPQLGSSSTPGPAWKVYVAPKVDMKSVMAE
AAASQIKPSKSKEPLRTPSKSQLVPRSPPQTASNVGSTSSPQRVVRTSSYPGSPPTPSFPPLTPQKQKEGVVRQQ
QQQNVTPTKQGGSSLGNVLGVAGGSVMGPTITPVRMPAGNVKSGQRSVSGPSKAWAYTRPIDPIPPPVLISPTPT
PSEPSSSTLKTTTKSFLAIQQEEEEQQQQFGDLQRGDKRSLLDIQEEERARRQEEEFLKWWEEEEVRVKMEMEVA
QSSGSGKSKRGGRKGGGEKGERRGGGGGSEGSGRGGPKGRKEGRKVQKNPGDNNATPPSTSSTRPPPRNHRKNAA
QGQEPILPMSSGS*
Coding >Agabi119p4|659750
ATGAGCTTGCTCCATGACGCATTCAACGCACGCAATCTCCATCTCTTCCAGCGCTTGGTGGATACCTCGAATGCC
GCAGACAAGTCCGCGTCGGTTTCTAGCACCAGTGTCGGCAAGGTCTCGAAGCACAGTTCGCTTGGTAACATAGAC
GTCAATCAGAGAGACTGGCTGGGCCGAACAGTTCTGCACCTCGCTTCGGCCGCCATCGAACATTTGGATTATGTT
CGGATTTTGCTCAAGCATCCCGCTATCAGCGTCAATGCTGCGGATACAGAAAGCCATTGGACTCCTCTCCATCGT
TCGCTGTATAGCGCTAATCTTCCAGCGGCCCGTCTCCTCCTTCAGCGTCCGGATATCGACATCTTCCTCAAAGAC
AATGAGGGCTACACCGCGTTCGACCTGTACAATTCTACCCTCGTCGGGACAAAGCCATCTCCGGAAGAAACAGGT
GGTTATGCTGACCTATACACCTGGGGCACGAACGTAAATGCCGCCCTTGGGCTCGGCGATAGCAATGACAGGGCA
TATCCAGAACTAGTCGTCTTTCCTCGCAGAGAAGATGAGGCTGATTTGGAGAGACAAACCTTATCGGCGCGATTC
TTGCCGATCAAAGCCGAACATGTAGAGATGTCGAAGTTACACACTGTTGTTTCGACATCGGAAACTGGAGGAAAC
CTGCGTGTTTGTGGGTTCGGCAGTGGCGGAAGGCTAGGACCCAACTCTCACACACAATACCTGCTTAAATCTCTT
TCTCAACTCACGCAAGTCATTACCGCGATCGCGTTGGGCCAAGACCACACTCTAGCTCTTACCAAAGCAGGTGAA
GTTCTTAGCTGGGGACTCAATCGATTCTCGCAACTGGGTTATCCTGTTGACCCGCCGACCAGCGGACGTCTCGAG
GAACCTATACAGTATTCACCCAGGAGGGTTCAAGGTCCCTTGAAAAAGGAAGTTGTCAAAGGTGTCGCAGCTAGC
AAAGTCGCTTCGGCTTGTTGGACCGACGACAGTGTCTATACATGGGGAACGAATAACGGCCAGCTGGGATATGAC
AAAGCTGCCCAACCAGTTCAGGTCCAGCCGCGCAAAGTCTCGCGTTTAACAGTGTCTGTTATCTCGATCGTTATG
TCTGAAAACGTAATGGCATGCCTTATGCAAAACCGACAAGTGGAATGTTTCTATGACGATGGGCATCATCGTATC
AATTTTCCAACGCTTGCGTTTCCATCGCCGATTCGTCCCTACCGTCCACCGCAAGCCGCTAAGGATTCTCGCATG
GCAAAGATCACATGCTGTGGTGACGTCTTTGCGGCGCTAACGTCGCACGGAGAGGTGTATATTTTCTCTCCATCT
AGCAGCCACTCTGCCAACTCCATTCCCTCTTCGTCATCTTCTGCCAACCTTTCCACTAGTTTTAATGATTCTGAG
GTGCCTACACGTATGGGCGGCCCATTCAAATGCCAACGCGTTTGGGCTCTACGTAAAAAGTTCAGCGCGGTCAAG
GATGTCGCTTTAGGAGCGGACGGATCGATCATTATCTGTACCGAATCTGGCCATGTCTACGTTCGGACACGCAAC
GTCAAGATGTCGTCTGTGGGCGGTTCTGGATCTTCAAGCAGCCAAAAAGCATTTAAATTCGTCAAGGTCCCTGGT
TTACAACGTGTTACGAGGGTTTGTGCTAGTGCCAGCGGCGCTTTTGGTGCTTTGAGAGTTGAATATAGGATGAAA
AACGTTGAAGTGAAGGGAAATTTCGTTGCACAGGACTTGAGTCGTGTCCGACCTTGGTTGGAATCTGGGAAGGAT
GATGCTAGCCTGGATACGCGTGTTATGGAATCCGACGATGAAGGTGAAGACTCGGGTCGGGATAAAGAGGAGAAC
GCGATCTCTTTTTTTGGTTACGGACACGAGTCGGATAATGAGGACGCCGAGGGAAGGGGTGAAGATGATGCGATT
GTAAATGACATTCGATTTCTCAAAGAAATGTGCGATGCCATAAAGAGAGAGGACAAGAGGAAAAAGGATGGGCGT
CGTCTCGAGCACATGCATTTACGCCATGGCGCAGACACCCTCCTCGTCCTAAGCTCTTTCAACATCGTATTTCCG
GTTCACCGAGCTATATTGGGTGCGCGATCGAAGGTTTTGTGCGGAATATCAAGATCAGCCTTTTATCGCCTCTAC
AACGATATCCTGCCAATACTAAGCCGATATGCGGACCGGGATCCAACCAGGATCTCAACGTCGATTATCAATTCT
TATGCTAAAGGGTTGAAAATCAAAATGGATCCGGGGTTGATCAAGAATGAATTACAGGTGCTTGGAAGGATGTTG
GATCTGTCCGAGATGTTGAAGGTTCTAGAGAGGCCTGTTAAGTCGGATGTTAGGCCGACTTTGGTGAGGGATTTG
AGCGAATTGTTCGATATTGTCAATCTGGAGAGGGACGACGATGATGATGAGGGAGGGGTGGAGAAAGTTCCGCGA
GCACTTTGTGAAGATGTTATACTGGAACTTGCGGATCGGGAAGTCTTCACGCATTCGGTGATCCTTAGGTCGAGA
TCGAATTTGTTCAAGAGCTTCTTTGATGAACCTGTTTGGACGCTGAACCGATGGGAGACGGAAGGCATCGATTAC
GTTGAAGGAGAACATGGAATCTTGAGGATTGATTTGAAACATTTGAAATGGCGGGTGATGGAATTTGTGCTGAAG
TTTATGTGTTGTGGGTGTGATAAAGAGTTGTTTGAGCGGGCGGAATTCATTGACGGTGTTGATGATCTGGTGGAA
TTTATGTTTGAAGTCATGGCTGCAGCGAACGAATTACTCGTGGACCGCCTCGTCCTCCTTTGCTCAGAAGTTATC
CTAACCTATACCTCACTCCACAATGCGTGCTATGTCCTTTATTTAGCGACCTATTACTCCGCCACGCAACTCATC
GATCGCGTACAATCATTTATCACAGCGAATATGGAATTATTCCTTCAATCATACATGTTAGACGATATCCCTCTA
GATCTCCTCACCCAATTATCGAATTACGCACAGGAAAAGCAAAAAGAGAAAGCGCCGTTTGTTAGAGGTGGTGTG
CTCGAGGAAGGGGTTATGGAGAAATGGAGAAAGTGGGTTGAGGATTTGGATGTTCCGATACCTATTGTGCGGAGC
AATAAACCTTGGAAGGAGAAGAAAGGTTTGCCTTTACCTGATTTTGGGAAAGATAAGAGAGGAGGAAGGGAGAAG
GGGCTAAGGAGACCGCCGAGTGGAGATGATATATTTATCATGGATGATACGGATTTACTATCACCGCAACTGGGC
TCGAGTAGCACGCCTGGACCGGCATGGAAAGTTTACGTTGCGCCAAAGGTTGATATGAAAAGTGTCATGGCTGAG
GCCGCTGCCAGTCAGATCAAACCTAGCAAGTCTAAAGAACCACTTCGGACACCTTCGAAATCTCAACTGGTACCA
CGATCACCGCCACAAACAGCATCCAACGTGGGCTCAACTTCATCCCCGCAGAGAGTTGTTCGAACATCGTCATAT
CCTGGATCTCCCCCGACGCCGTCTTTCCCGCCTTTAACTCCGCAGAAACAAAAGGAAGGTGTTGTTAGGCAGCAG
CAGCAGCAGAATGTTACTCCGACGAAACAGGGTGGTTCGAGTTTAGGGAATGTTTTAGGGGTGGCTGGTGGATCT
GTGATGGGGCCTACGATTACGCCTGTGCGGATGCCTGCGGGGAATGTGAAGAGTGGGCAGCGAAGTGTTTCTGGT
CCGAGTAAAGCATGGGCATATACCCGTCCTATTGATCCTATACCACCCCCAGTCCTGATATCACCCACACCAACT
CCCAGCGAGCCTTCTTCATCCACATTAAAAACGACAACAAAATCATTTTTGGCGATCCAACAAGAGGAAGAAGAA
CAGCAACAACAATTCGGAGATTTACAGCGGGGAGATAAGAGATCGTTGTTGGATATTCAGGAAGAGGAGAGGGCG
AGGAGGCAAGAAGAGGAGTTTTTGAAGTGGTGGGAGGAGGAAGAGGTTAGGGTTAAGATGGAGATGGAGGTGGCA
CAGTCGAGTGGTAGTGGGAAATCGAAAAGAGGTGGAAGAAAAGGTGGTGGGGAGAAAGGTGAGAGACGTGGAGGA
GGGGGAGGGAGTGAAGGAAGCGGGAGGGGTGGACCTAAAGGACGTAAAGAAGGTAGAAAAGTTCAGAAGAACCCA
GGCGACAACAATGCTACTCCTCCATCAACATCTTCTACTCGACCACCACCACGGAATCATCGGAAAAACGCTGCT
CAAGGACAAGAACCTATTCTCCCCATGTCATCTGGATCTTAG
Transcript >Agabi119p4|659750
ATGAGCTTGCTCCATGACGCATTCAACGCACGCAATCTCCATCTCTTCCAGCGCTTGGTGGATACCTCGAATGCC
GCAGACAAGTCCGCGTCGGTTTCTAGCACCAGTGTCGGCAAGGTCTCGAAGCACAGTTCGCTTGGTAACATAGAC
GTCAATCAGAGAGACTGGCTGGGCCGAACAGTTCTGCACCTCGCTTCGGCCGCCATCGAACATTTGGATTATGTT
CGGATTTTGCTCAAGCATCCCGCTATCAGCGTCAATGCTGCGGATACAGAAAGCCATTGGACTCCTCTCCATCGT
TCGCTGTATAGCGCTAATCTTCCAGCGGCCCGTCTCCTCCTTCAGCGTCCGGATATCGACATCTTCCTCAAAGAC
AATGAGGGCTACACCGCGTTCGACCTGTACAATTCTACCCTCGTCGGGACAAAGCCATCTCCGGAAGAAACAGGT
GGTTATGCTGACCTATACACCTGGGGCACGAACGTAAATGCCGCCCTTGGGCTCGGCGATAGCAATGACAGGGCA
TATCCAGAACTAGTCGTCTTTCCTCGCAGAGAAGATGAGGCTGATTTGGAGAGACAAACCTTATCGGCGCGATTC
TTGCCGATCAAAGCCGAACATGTAGAGATGTCGAAGTTACACACTGTTGTTTCGACATCGGAAACTGGAGGAAAC
CTGCGTGTTTGTGGGTTCGGCAGTGGCGGAAGGCTAGGACCCAACTCTCACACACAATACCTGCTTAAATCTCTT
TCTCAACTCACGCAAGTCATTACCGCGATCGCGTTGGGCCAAGACCACACTCTAGCTCTTACCAAAGCAGGTGAA
GTTCTTAGCTGGGGACTCAATCGATTCTCGCAACTGGGTTATCCTGTTGACCCGCCGACCAGCGGACGTCTCGAG
GAACCTATACAGTATTCACCCAGGAGGGTTCAAGGTCCCTTGAAAAAGGAAGTTGTCAAAGGTGTCGCAGCTAGC
AAAGTCGCTTCGGCTTGTTGGACCGACGACAGTGTCTATACATGGGGAACGAATAACGGCCAGCTGGGATATGAC
AAAGCTGCCCAACCAGTTCAGGTCCAGCCGCGCAAAGTCTCGCGTTTAACAGTGTCTGTTATCTCGATCGTTATG
TCTGAAAACGTAATGGCATGCCTTATGCAAAACCGACAAGTGGAATGTTTCTATGACGATGGGCATCATCGTATC
AATTTTCCAACGCTTGCGTTTCCATCGCCGATTCGTCCCTACCGTCCACCGCAAGCCGCTAAGGATTCTCGCATG
GCAAAGATCACATGCTGTGGTGACGTCTTTGCGGCGCTAACGTCGCACGGAGAGGTGTATATTTTCTCTCCATCT
AGCAGCCACTCTGCCAACTCCATTCCCTCTTCGTCATCTTCTGCCAACCTTTCCACTAGTTTTAATGATTCTGAG
GTGCCTACACGTATGGGCGGCCCATTCAAATGCCAACGCGTTTGGGCTCTACGTAAAAAGTTCAGCGCGGTCAAG
GATGTCGCTTTAGGAGCGGACGGATCGATCATTATCTGTACCGAATCTGGCCATGTCTACGTTCGGACACGCAAC
GTCAAGATGTCGTCTGTGGGCGGTTCTGGATCTTCAAGCAGCCAAAAAGCATTTAAATTCGTCAAGGTCCCTGGT
TTACAACGTGTTACGAGGGTTTGTGCTAGTGCCAGCGGCGCTTTTGGTGCTTTGAGAGTTGAATATAGGATGAAA
AACGTTGAAGTGAAGGGAAATTTCGTTGCACAGGACTTGAGTCGTGTCCGACCTTGGTTGGAATCTGGGAAGGAT
GATGCTAGCCTGGATACGCGTGTTATGGAATCCGACGATGAAGGTGAAGACTCGGGTCGGGATAAAGAGGAGAAC
GCGATCTCTTTTTTTGGTTACGGACACGAGTCGGATAATGAGGACGCCGAGGGAAGGGGTGAAGATGATGCGATT
GTAAATGACATTCGATTTCTCAAAGAAATGTGCGATGCCATAAAGAGAGAGGACAAGAGGAAAAAGGATGGGCGT
CGTCTCGAGCACATGCATTTACGCCATGGCGCAGACACCCTCCTCGTCCTAAGCTCTTTCAACATCGTATTTCCG
GTTCACCGAGCTATATTGGGTGCGCGATCGAAGGTTTTGTGCGGAATATCAAGATCAGCCTTTTATCGCCTCTAC
AACGATATCCTGCCAATACTAAGCCGATATGCGGACCGGGATCCAACCAGGATCTCAACGTCGATTATCAATTCT
TATGCTAAAGGGTTGAAAATCAAAATGGATCCGGGGTTGATCAAGAATGAATTACAGGTGCTTGGAAGGATGTTG
GATCTGTCCGAGATGTTGAAGGTTCTAGAGAGGCCTGTTAAGTCGGATGTTAGGCCGACTTTGGTGAGGGATTTG
AGCGAATTGTTCGATATTGTCAATCTGGAGAGGGACGACGATGATGATGAGGGAGGGGTGGAGAAAGTTCCGCGA
GCACTTTGTGAAGATGTTATACTGGAACTTGCGGATCGGGAAGTCTTCACGCATTCGGTGATCCTTAGGTCGAGA
TCGAATTTGTTCAAGAGCTTCTTTGATGAACCTGTTTGGACGCTGAACCGATGGGAGACGGAAGGCATCGATTAC
GTTGAAGGAGAACATGGAATCTTGAGGATTGATTTGAAACATTTGAAATGGCGGGTGATGGAATTTGTGCTGAAG
TTTATGTGTTGTGGGTGTGATAAAGAGTTGTTTGAGCGGGCGGAATTCATTGACGGTGTTGATGATCTGGTGGAA
TTTATGTTTGAAGTCATGGCTGCAGCGAACGAATTACTCGTGGACCGCCTCGTCCTCCTTTGCTCAGAAGTTATC
CTAACCTATACCTCACTCCACAATGCGTGCTATGTCCTTTATTTAGCGACCTATTACTCCGCCACGCAACTCATC
GATCGCGTACAATCATTTATCACAGCGAATATGGAATTATTCCTTCAATCATACATGTTAGACGATATCCCTCTA
GATCTCCTCACCCAATTATCGAATTACGCACAGGAAAAGCAAAAAGAGAAAGCGCCGTTTGTTAGAGGTGGTGTG
CTCGAGGAAGGGGTTATGGAGAAATGGAGAAAGTGGGTTGAGGATTTGGATGTTCCGATACCTATTGTGCGGAGC
AATAAACCTTGGAAGGAGAAGAAAGGTTTGCCTTTACCTGATTTTGGGAAAGATAAGAGAGGAGGAAGGGAGAAG
GGGCTAAGGAGACCGCCGAGTGGAGATGATATATTTATCATGGATGATACGGATTTACTATCACCGCAACTGGGC
TCGAGTAGCACGCCTGGACCGGCATGGAAAGTTTACGTTGCGCCAAAGGTTGATATGAAAAGTGTCATGGCTGAG
GCCGCTGCCAGTCAGATCAAACCTAGCAAGTCTAAAGAACCACTTCGGACACCTTCGAAATCTCAACTGGTACCA
CGATCACCGCCACAAACAGCATCCAACGTGGGCTCAACTTCATCCCCGCAGAGAGTTGTTCGAACATCGTCATAT
CCTGGATCTCCCCCGACGCCGTCTTTCCCGCCTTTAACTCCGCAGAAACAAAAGGAAGGTGTTGTTAGGCAGCAG
CAGCAGCAGAATGTTACTCCGACGAAACAGGGTGGTTCGAGTTTAGGGAATGTTTTAGGGGTGGCTGGTGGATCT
GTGATGGGGCCTACGATTACGCCTGTGCGGATGCCTGCGGGGAATGTGAAGAGTGGGCAGCGAAGTGTTTCTGGT
CCGAGTAAAGCATGGGCATATACCCGTCCTATTGATCCTATACCACCCCCAGTCCTGATATCACCCACACCAACT
CCCAGCGAGCCTTCTTCATCCACATTAAAAACGACAACAAAATCATTTTTGGCGATCCAACAAGAGGAAGAAGAA
CAGCAACAACAATTCGGAGATTTACAGCGGGGAGATAAGAGATCGTTGTTGGATATTCAGGAAGAGGAGAGGGCG
AGGAGGCAAGAAGAGGAGTTTTTGAAGTGGTGGGAGGAGGAAGAGGTTAGGGTTAAGATGGAGATGGAGGTGGCA
CAGTCGAGTGGTAGTGGGAAATCGAAAAGAGGTGGAAGAAAAGGTGGTGGGGAGAAAGGTGAGAGACGTGGAGGA
GGGGGAGGGAGTGAAGGAAGCGGGAGGGGTGGACCTAAAGGACGTAAAGAAGGTAGAAAAGTTCAGAAGAACCCA
GGCGACAACAATGCTACTCCTCCATCAACATCTTCTACTCGACCACCACCACGGAATCATCGGAAAAACGCTGCT
CAAGGACAAGAACCTATTCTCCCCATGTCATCTGGATCTTAG
Gene >Agabi119p4|659750
ATGAGCTTGCTCCATGACGCATTCAACGCACGCAATCTCCATCTCTTCCAGCGCTTGGTGGATACCTCGAATGCC
GCAGACAAGTCCGCGTCGGTTTCTAGCACCAGTGTCGGCAAGGTCTCGAAGCACAGTTCGCTTGGTAACATAGAC
GTCAATCAGAGAGACTGGCTGGGCCGAACAGTTCTGCACCTCGCTTCGGCCGCCATCGAACATTTGGATTATGTT
CGGATTTTGCTCAAGCATCCCGCTATCAGCGTCAATGCTGCGGATACAGAAAGCCATTGGACTCCTCTCCATCGT
TCGCTGTATAGCGCTAATCTTCCAGCGGCGTAAGTGGAAATTACAGGCTTCTTCGTCATATCGGTTTCTTATCAT
CTCTGCAGCCGTCTCCTCCTTCAGCGTCCGGATATCGACATCTTCCTCAAAGACAATGAGGGCTACACCGCGTTC
GACCTGTACAATTCTACCCTCGTCGGGACAAAGCCATCTCCGGAAGAAACAGGTGGTTATGCTGACCTATACACC
TGGGGCACGAACGTGTGTGTATCCGCTTTCCCCGGAATTCAAATGCATCGGCCCATTCATTCCCATTCCCCCCCA
GAAATGCCGCCCTTGGGCTCGGCGATAGCAATGACAGGGCATATCCAGAACTAGTCGTCTTTCCTCGCAGAGAAG
ATGAGGCTGATTTGGAGAGACAAACCTTATCGGCGCGATTCTTGCCGATCAAAGCCGAACATGTAGAGATGTCGA
AGTTACACACTGGTCCGCTACATGCTCATGACATCTATACATCATTAACATCTTGCCTTTAGTTGTTTCGACATC
GGAAACTGGAGGAAACCTGCGTGTTTGTGGGTTCGGCAGTGGCGGAAGGCGAGCCTATCTTAGCGATTTAGTGCA
TGGTCACTAATGCACGTTTTATTCATTTAGGCTAGGACCCAACTCTCACACACAATACCTGCTTAAATCTCTTTC
TCAACTCACGCAAGTCATTACCGCGATCGCGTTGGGCCAAGACCACACTCTAGCTCTTACCAAAGCAGGTGAAGT
TCTTAGCTGGGGACTCAATCGATTCTCGCAACTGGGTTATCCTGTTGACCCGCCGACCAGCGGACGTCTCGAGGA
ACCTATACAGTATTCACCCAGGAGGGTTCAAGGTCCCTTGAAAAAGGAAGTTGTCAAAGGTGTCGCAGCTAGCAA
AGTCGCTTCGGCTTGTTGGACCGACGACAGTGTCTATACATGGGGAACGAATAACGGCCAGCTGGGTCAGTATAG
CGTGTGTGAGAAATATAATTTTTTCACTGATTTATTTTTAATTCTAGGATATGACAAAGCTGCCCAACCAGTTCA
GGTCCAGCCGCGCAAAGTCTCGCGTTTAACAGTGTCTGTTATCTCGATCGTTATGTCTGTGAGTGTATCCCAGGA
AAGTTGTGCGGTATTCTAACCTGCTCCTAAAAGGAAAACGTAATGGCATGCCTTATGCAAAACCGACAAGTGGAA
TGTTTCTATGACGATGGGCATCATCGTATCAAGTCAGTTTCCTCCCTATAGCTTTCCATGTCTAATCAGTATAGC
AGTTTTCCAACGCTTGCGTTTCCATCGCCGATTCGTCCCTACCGTCCACCGCAAGCCGCTAAGGATTCTCGCATG
GCAAAGATCACATGCTGTGGTGACGTCTTTGCGGCGCTAACGTCGCACGGAGAGGTGTATATTTTCTCTCCATCT
AGCAGCCACTCTGCCAACTCCATTCCCTCTTCGTCATCTTCTGCCAACCTTTCCACTAGTTTTAATGATTCTGAG
GTGCCTACACGTATGGGCGGCCCATTCAAATGCCAACGCGTTTGGGCTCTACGTAAAAAGTTCAGCGCGGTCAAG
GATGTCGCTTTAGGAGCGGACGGATCGATCATTATCTGTACCGAATCTGGCCATGTCTACGTTCGGACACGCAAC
GTCAAGATGTCGTCTGTGGGCGGTTCTGGATCTTCAAGCAGCCAAAAAGCATTTAAATTCGTCAAGGTCCCTGGT
TTACAACGTGTTACGAGGGTTTGTGCTAGTGCCAGCGGCGCTTTTGGTGCTTTGAGAGTTGAATATAGGATGAAA
AACGTTGAAGTGAAGGGAAATTTCGTTGCACAGGACTTGAGTCGTGTCCGACCTTGGTTGGAATCTGGGAAGGAT
GATGCTAGCCTGGATACGCGTGTTATGGAATCCGACGATGAAGGTGAAGACTCGGGTCGGGATAAAGAGGAGAAC
GCGATCTCTTTTTTTGGTTACGGACACGAGTCGGATAATGAGGACGCCGAGGGAAGGGGTGAAGATGATGCGATT
GTAAATGACATTCGATTTCTCAAAGAAATGTGCGATGCCATAAAGAGAGAGGACAAGAGGAAAAAGGATGGGCGT
CGTCTCGAGCACATGCATTTACGCCATGGCGCAGACACCCTCCTCGTCCTAAGCTCTTTCAACATCGTATTTCCG
GTTCACCGAGCTATATTGGGTGCGCGATCGAAGGTTTTGTGCGGTATCCTTTCGGCCAAGACGAAAAAGAAGTCT
TTTGTATTGGATGAGCAAAGGAATATCAAGATCAGCCTTTTATCGCCTCTACAACGATATCCTGCCAATACTAAG
CCGATATGCGGACCGGGATCCAACCAGGTAACGCAACTATCCATCACAGGTGTCCATCCACTTTCGATTCTCATC
CTTTTTAATTATCTCTACTCCGACAACCTCGTGGCAATATGGGACCGTAGGATCTCAACGTCGATTATCAATTCT
TATGCTAAAGGGTTGAAAATCAAAATGGATCCGGGGTTGATCAAGAATGAATTACAGGTGCTTGGAAGGATGTTG
GATCTGTCCGAGATGTTGAAGGTTCTAGAGAGGCCTGTTAAGTCGGATGTTAGGCCGACTTTGGTGAGGGATTTG
AGCGAATTGTTCGATATTGTCAATCTGGAGAGGGACGACGATGATGATGAGGGAGGGGTGGAGAAAGTTCCGCGA
GCACTTTGTGAAGATGTTATACTGGAACTTGCGGATCGGGAAGTCTTCACGCATTCGGTGATCCTTAGGTCGAGA
TCGAATTTGTTCAAGAGCTTCTTTGATGAACCTGTTTGGACGCTGAACCGATGGGAGACGGAAGGCATCGATTAC
GTTGAAGGAGAACATGGAATCTTGAGGATTGATTTGAAACATTTGAAATGGCGGGTGATGGAATTTGTGCTGAAG
TTTATGTGTTGTGGGTGTGATAAAGAGTTGTTTGAGCGGGCGGAATTCATTGACGGTGTTGATGATCTGGTGGAA
TTTATGTTTGAAGTCATGGCTGCAGCGGTGTGTTCCTTCTCTGATTTTCGATGGTTTGGCCCTAATTTTGTATCA
TAGAACGAATTACTCGTGGACCGCCTCGTCCTCCTTTGCTCAGAAGTTATCCTAACCTATACCTCACTCCACAAT
GCGTGCTATGTCCTTTATTTAGCGACCTATTACTCCGCCACGCAACTCATCGATCGCGTACAATCATTTATCACA
GCGAATATGGAATTATTCCTTCAATCATACATGTTAGACGATATCCCTCTAGATCTCCTCACCCAATTATCGAAT
TACGCACAGGAAAAGCAAAAAGAGAAAGCGCCGTTTGTTAGAGGTGGTGTGCTCGAGGAAGGGGTTATGGAGAAA
TGGAGAAAGTGGGTTGAGGATTTGGATGTTCCGATACCTATTGTGCGGAGCAATAAACCTTGGAAGGAGAAGAAA
GGTTTGCCTTTACCTGATTTTGGGAAAGATAAGAGAGGAGGAAGGGAGAAGGGGCTAAGGAGACCGCCGAGTGGA
GATGATATATTTATCATGGATGATACGGATTTACTATCACCGCAACTGGGCTCGAGTAGCACGCCTGGACCGGCA
TGGAAAGTTTACGTTGCGCCAAAGTATGCATCTTATTTTGGAGGAGTATCAATGCTAACGTTTGATTATAGGGTT
GATATGAAAAGTGTCATGGCTGAGGCCGCTGCCAGTCAGATCAAACCTAGCAAGTCTAAAGAACCACTTCGGACA
CCTTCGAAATCTCAACTGGTACCACGATCACCGCCACAAACAGCATCCAACGTGGGCTCAACTTCATCCCCGCAG
AGAGTTGTTCGAACATCGTCATATCCTGGATCTCCCCCGACGCCGTCTTTCCCGCCTTTAACTCCGCAGAAACAA
AAGGAAGGTGTTGTTAGGCAGCAGCAGCAGCAGAATGTTACTCCGACGAAACAGGGTGGTTCGAGTTTAGGGAAT
GTTTTAGGGGTGGCTGGTGGATCTGTGATGGGGCCTACGATTACGCCTGTGCGGATGCCTGCGGGGAATGTGAAG
AGTGGGCAGCGAAGTGTTTCGTGCGTGTTTTGTTCTGTTGTGAATGATATACCTATATCTAATTTTTGATTTATT
CTAGTGGTCCGAGTAAAGCATGGGCATATACCCGTCCTATTGATCCTATACCACCCCCAGTCCTGATATCACCCA
CACCAACTCCCAGCGAGCCTTCTTCATCCACATTAAAAACGACAACAAAATCATTTTTGGCGATCCAACAAGAGG
AAGAAGAACAGCAACAACAATTCGGAGATTTACAGCGGGGAGATAAGAGATCGTTGTTGGATATTCAGGAAGAGG
AGAGGGCGAGGAGGCAAGAAGAGGAGTTTTTGAAGTGGTGGGAGGAGGAAGAGGTTAGGGTTAAGATGGAGATGG
AGGTGGCACAGTCGAGTGGTAGTGGGAAATCGAAAAGAGGTGGAAGAAAAGGTGGTGGGGAGAAAGGTGAGAGAC
GTGGAGGAGGGGGAGGGAGTGAAGGAAGCGGGAGGGGTGGACCTAAAGGACGTAAAGAAGGTAGAAAAGTTCAGA
AGAACCCAGGCGACAACAATGCTACTCCTCCATCAACATCTTCTACTCGACCACCACCACGGAATCATCGGAAAA
ACGCTGCTCAAGGACAAGAACCTATTCTCCCCATGTCATCTGGATCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail