Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|658750
Gene name
Locationscaffold_06:354821..355297
Strand-
Gene length (bp)476
Transcript length (bp)363
Coding sequence length (bp)363
Protein length (aa) 121

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10342 Kre9_KNH Kre9/KNH-like N-terminal Ig-like domain 3.9E-07 25 118

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74947|YJBA_SCHPO Uncharacterized protein C553.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.10 PE=3 SV=1 5 118 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|658750
MQATVFAALLLSFVSSSFAYLVNVPNDHQGWSAYGPQTLSWSRVNTDATSFAVFLTNQDRTVLLEDFLVANYIDG
TRLTTKIYPGRGGFPTGSHFRVNLVKNANEIHTIYAQSNEFTIHN*
Coding >Agabi119p4|658750
ATGCAAGCAACCGTCTTCGCTGCTCTTCTCCTCTCTTTTGTTAGCTCTTCCTTTGCCTACTTGGTTAACGTTCCA
AACGACCACCAGGGCTGGTCAGCCTATGGTCCTCAGACTCTCAGCTGGAGCCGTGTCAATACTGATGCCACATCT
TTCGCTGTCTTCCTCACCAATCAGGACCGCACTGTCCTACTTGAAGACTTCCTAGTCGCTAATTACATTGATGGC
ACTCGCCTCACCACCAAAATTTACCCTGGTCGCGGAGGATTCCCAACAGGTTCTCACTTCCGTGTCAACCTCGTG
AAGAACGCGAACGAGATACACACCATTTACGCTCAATCTAATGAATTTACCATCCATAACTAG
Transcript >Agabi119p4|658750
ATGCAAGCAACCGTCTTCGCTGCTCTTCTCCTCTCTTTTGTTAGCTCTTCCTTTGCCTACTTGGTTAACGTTCCA
AACGACCACCAGGGCTGGTCAGCCTATGGTCCTCAGACTCTCAGCTGGAGCCGTGTCAATACTGATGCCACATCT
TTCGCTGTCTTCCTCACCAATCAGGACCGCACTGTCCTACTTGAAGACTTCCTAGTCGCTAATTACATTGATGGC
ACTCGCCTCACCACCAAAATTTACCCTGGTCGCGGAGGATTCCCAACAGGTTCTCACTTCCGTGTCAACCTCGTG
AAGAACGCGAACGAGATACACACCATTTACGCTCAATCTAATGAATTTACCATCCATAACTAG
Gene >Agabi119p4|658750
ATGCAAGCAACCGTCTTCGCTGCTCTTCTCCTCTCTTTTGTTAGCTCTTCCTTTGCCTACTTGGTTAACGTTCCA
AACGACCACCAGGGCTGGTCAGCCTATGGTCCTCAGACGTGCGTATGGAATATGAACGTCCTCGTATTTCATGGT
TAACCGTAATGTCGTAGTCTCAGCTGGAGCCGTGTCAATACTGATGCCACATCTTTCGCTGTCTTCCTCACCAAT
CAGGTACGACCGCCATTTACCGGGGAGTATTAGTGGTACTCAATGTGCATTTGAATTATTAGGACCGCACTGTCC
TACTTGAAGACTTCCTAGTCGCTAATTACATTGATGGCACTCGCCTCACCACCAAAATTTACCCTGGTCGCGGAG
GATTCCCAACAGGTTCTCACTTCCGTGTCAACCTCGTGAAGAACGCGAACGAGATACACACCATTTACGCTCAAT
CTAATGAATTTACCATCCATAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail