Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|658350
Gene name
Locationscaffold_06:320661..324774
Strand-
Gene length (bp)4113
Transcript length (bp)4113
Coding sequence length (bp)4113
Protein length (aa) 1371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 3.1E-29 699 800
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 7.1E-22 440 601
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 4.8E-21 667 770
PF17921 Integrase_H2C2 Integrase zinc binding domain 3.8E-17 931 986
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 1.5E-08 1317 1364
PF08284 RVP_2 Retroviral aspartyl protease 2.2E-05 123 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 384 1290 7.0E-111
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 384 1287 4.0E-110
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 400 1297 4.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 384 1290 7.0E-111
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 384 1287 4.0E-110
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 400 1297 4.0E-107
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 400 1297 4.0E-107
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 400 1297 4.0E-107
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 400 1297 1.0E-106
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 400 1297 2.0E-106
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 400 1297 2.0E-106
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 401 1120 4.0E-73
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 416 1078 9.0E-72
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 389 1122 8.0E-66
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 372 1012 1.0E-61
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 360 847 3.0E-51
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 412 820 3.0E-43
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 409 820 3.0E-42
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 409 820 2.0E-41
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 409 820 3.0E-41
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 409 820 5.0E-41
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 409 820 4.0E-40
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 420 820 7.0E-40
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 409 820 1.0E-39
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 409 819 4.0E-39
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 410 684 4.0E-36
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 420 821 1.0E-33
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 414 948 1.0E-33
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 414 948 8.0E-33
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 409 867 4.0E-26
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 361 798 1.0E-24
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 400 825 6.0E-22
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 356 793 4.0E-21
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 400 774 6.0E-21
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 400 825 7.0E-21
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 909 1157 1.0E-19
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 400 774 1.0E-19
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 400 806 1.0E-19
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 400 806 2.0E-19
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 409 743 1.0E-18
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 421 648 5.0E-18
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 416 743 5.0E-18
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 929 1240 1.0E-17
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 904 1158 2.0E-17
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 449 574 9.0E-17
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 926 1158 1.0E-16
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 370 743 2.0E-16
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 926 1158 3.0E-16
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 370 743 3.0E-16
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 370 743 3.0E-16
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 370 743 3.0E-16
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 370 758 8.0E-16
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 370 743 2.0E-15
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 370 743 2.0E-15
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 891 1158 1.0E-14
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 410 653 2.0E-14
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 342 743 2.0E-14
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 917 1108 3.0E-14
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 400 743 5.0E-14
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 410 653 7.0E-14
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 410 643 8.0E-14
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 410 642 1.0E-13
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 410 653 6.0E-13
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 411 642 1.0E-11
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 518 759 1.0E-11
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 410 653 1.0E-11
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 411 642 4.0E-11
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 879 1264 5.0E-11
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 571 684 5.0E-11
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 898 1264 1.0E-10
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 414 562 1.0E-10
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 936 1292 2.0E-10
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 836 1264 2.0E-10
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 879 1264 2.0E-10
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 410 692 5.0E-10
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 934 1130 9.0E-10
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 1010 1264 1.0E-09
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 947 1264 2.0E-09
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 411 642 2.0E-09
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 911 1264 2.0E-09
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 911 1264 5.0E-09
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 410 692 5.0E-09
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 911 1264 6.0E-09
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal a-particle MIA14 GN=pol PE=3 SV=1 410 614 6.0E-09
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 410 615 2.0E-08
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 528 679 4.0E-08
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 958 1264 5.0E-08
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 393 615 5.0E-08
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 1010 1264 1.0E-07
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 393 615 2.0E-07
sp|P25059|POL_BLVAU Pol polyprotein OS=Bovine leukemia virus (isolate Australian) GN=pol PE=3 SV=1 410 653 2.0E-07
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 394 615 2.0E-07
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 394 615 2.0E-07
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 512 679 3.0E-07
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 394 615 3.0E-07
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 393 615 3.0E-07
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 912 1096 4.0E-07
sp|P03361|POL_BLVJ Pol polyprotein OS=Bovine leukemia virus (isolate Japanese BLV-1) GN=pol PE=3 SV=1 410 653 5.0E-07
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 836 1264 7.0E-07
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 922 1202 7.0E-07
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 836 1264 9.0E-07
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 836 1264 9.0E-07
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 393 615 1.0E-06
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 922 1202 1.0E-06
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 394 581 1.0E-06
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 401 615 2.0E-06
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 411 586 2.0E-06
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 410 575 3.0E-06
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 416 575 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|658350
MYNFQQLVTASIEDLDAQFDAAQNTDFLDGSSDLTVNATFPLVSGSPMNSAFGASTSYHVDPTTFQADDVFAGAV
MYDDNNLPMDDVLDDDEMYVLPSTSPPPHDHLLWTCYVDSPHGPSARVQALIDHGCPTVLISSNLADGLDLRRLT
LGKPLSLAGVGGGTFSCTHFVKLHVHSVDDTWKAQTVRALVVPQLHFDLILGLEWLRANKIIVDMAENSVVAKDS
GYILLDASLPCLRRPSYIPSPAATIVRKATRHLPPSSVAPSRVAAITSSRNCLRSCLVELQRTVRRVPPKRSTFL
SFGLIKNRLTSLASLQTHSTSLSSAEATTKSEFNDLFLDSRSSAKIPLGPVNSALQLEDSKAKSEFHDLFPEKLP
HVSALPCDVRHRIIITAAEKICVGREYTCPRKWREAWKGLIEEHLQAGRIRPSSSPFAAPSFLVPKADPSATPRW
VIDYRRLNAYTVPDRYPLPRIDDILSDCAKGKIWGKIDMTNAFFQTRMHPDDIKYTACRTPFGLYEWTVMPMGLR
NSPSTQQRCVTSALRHLIGHICHVYLDDIVIWSNSLEEHVKNVRSVLDALRANSLLCSMKKSALFCDEILFLGHK
ISRNGIEADPAKVDKILSWPIPRNSTEVRRFLGLVKFVAHYLSDLAQHTHILYPLTTKTADKHFPSWSTAHQTAF
DSIKLLVTSRRCLTTINHDNLGSNKVFVTCDASIIGTGAVLSYGPSWSQSRPVAFDSQQYAPPQRHYPTHEQELL
AIIRALRKWRPDLLGLHFEIYTDHKTLLNFDTQKDLSRRQARWMEFLSQYDYKINYVAGVLNTAADALSRLPHTS
PSSSLPGDPLLIAATFLSSSASLFVPSHPLPSPHSASSDSSLSVASLVRLDAENTLLEEVRHGYLLDPFTVKLKD
ALRLHSTPPNSFPERDGLFFYHNRLVIPNHNNLRERLFYLAHDQLGHFGFDKSYANIRSSFYWPNMRSDLERSYV
PSCEACQMNKSPTTKRAGPLHPLPIPDDRFSSVAIDFIGPLPDDNGFDFLATVTDRLGADVKLIPCKSSVTAEEF
AQLFIDHWICDNGCPREIISDRDRRFVSKFWQSLTQILQINHICSSAFHPQTDGASERTNKTVLQCLRFFVDRNQ
KGWVSALPRVRFNIMSSVNASTSFSGFQLKSGFSPRPIPPPPSVPKNPADALSRAASIIQSFHDDVLQAKDNLLA
AKIVQAHFANDYRSEDPGYKVGDRVWLNTSNCRRDYVHRGSGRAAKFMPRFDGPFFITKAYPESSSYTLDLPLSS
SIHPTFHVSLLRPFIPNDDLKFPNRIRPNPEPVLVDGEFEHEIEKIIDERKRGRGKQYLVRWKHFSSTDDEWIPH
AKLANNKALDDWERSSEPCL*
Coding >Agabi119p4|658350
ATGTATAATTTCCAACAGCTTGTTACTGCATCCATCGAGGATCTCGATGCTCAATTCGATGCCGCTCAGAATACC
GATTTCCTTGACGGGTCCTCTGACCTCACTGTCAATGCCACCTTCCCTCTGGTTTCTGGTTCTCCCATGAACTCC
GCCTTCGGTGCTTCTACCTCTTATCACGTTGATCCCACCACCTTCCAGGCTGACGACGTCTTTGCTGGTGCTGTT
ATGTACGATGATAACAACTTGCCCATGGATGATGTTCTGGATGATGACGAAATGTATGTCCTTCCTTCTACGTCC
CCACCTCCTCATGATCACTTGCTGTGGACGTGTTACGTCGACAGTCCTCATGGCCCTTCTGCTCGTGTCCAAGCC
CTCATTGATCATGGTTGTCCCACAGTATTGATTTCGAGTAATCTTGCCGATGGCTTAGACCTGCGTCGTTTGACT
CTGGGGAAACCTTTATCTCTTGCTGGTGTAGGAGGAGGAACCTTTTCTTGCACACATTTCGTGAAACTTCATGTC
CATTCCGTAGATGACACCTGGAAAGCTCAGACTGTCCGTGCCCTTGTCGTACCTCAATTGCATTTTGATTTGATC
CTTGGTCTTGAATGGCTTCGTGCAAACAAAATTATTGTTGACATGGCAGAGAATTCTGTTGTTGCCAAGGACTCT
GGTTATATTTTGCTCGATGCCTCCCTCCCTTGCCTACGACGCCCCTCATACATTCCTTCCCCTGCTGCCACAATT
GTTCGTAAAGCCACACGACATTTACCTCCTTCTTCTGTTGCGCCATCTCGTGTTGCTGCCATTACATCCTCTCGC
AACTGCTTGCGCTCTTGCCTCGTAGAACTTCAACGAACGGTCCGTCGTGTGCCTCCGAAACGTTCCACATTCCTT
TCTTTCGGGTTGATCAAGAATCGTCTCACTTCGCTGGCTTCTCTCCAAACTCATTCTACATCTCTCTCTTCCGCC
GAAGCCACCACAAAGTCAGAATTCAACGATCTTTTCCTTGACTCCCGTTCCTCTGCTAAGATACCGTTGGGACCT
GTCAACAGTGCCCTGCAGCTTGAAGACTCCAAGGCGAAGTCAGAATTCCACGATCTTTTCCCGGAGAAACTCCCC
CACGTTAGCGCCCTCCCTTGTGATGTCCGTCATCGCATCATCATCACTGCAGCCGAGAAAATCTGTGTCGGTCGT
GAATATACTTGTCCTCGGAAATGGCGAGAGGCTTGGAAAGGGCTCATTGAAGAACATCTTCAGGCTGGTAGAATT
CGGCCCTCCTCTTCCCCTTTTGCTGCTCCTTCTTTTCTCGTTCCAAAAGCCGATCCGTCTGCTACTCCACGTTGG
GTCATTGACTATCGCCGGCTTAATGCATACACCGTGCCCGACAGATACCCGCTCCCCCGCATTGACGACATTTTG
TCCGATTGTGCAAAAGGAAAGATATGGGGAAAAATCGATATGACGAACGCCTTCTTTCAAACACGTATGCACCCT
GATGACATCAAATACACTGCCTGCCGCACCCCGTTTGGCCTCTACGAATGGACTGTAATGCCTATGGGCCTTCGT
AATTCACCTTCCACTCAGCAGAGGTGTGTCACATCTGCTCTCCGTCATCTCATAGGTCATATCTGCCATGTCTAT
TTAGACGACATTGTCATCTGGTCCAACTCTCTTGAAGAACACGTTAAAAATGTGCGTTCCGTCCTTGATGCTCTT
CGCGCCAACAGCCTTCTTTGCTCTATGAAAAAGTCTGCGCTTTTCTGTGATGAAATCCTCTTTCTCGGCCATAAG
ATCTCTCGGAATGGAATAGAAGCTGATCCGGCCAAAGTCGATAAGATTCTTTCCTGGCCTATCCCCCGCAACAGC
ACTGAAGTACGACGTTTCCTCGGCCTCGTTAAATTTGTTGCACATTACCTTTCTGATCTCGCTCAACATACCCAC
ATTTTGTACCCTCTCACAACAAAGACGGCCGATAAGCATTTCCCTTCCTGGTCTACTGCTCACCAAACTGCCTTT
GATTCCATCAAACTCCTTGTCACAAGTCGGCGTTGCCTTACTACCATCAACCATGACAATCTTGGCTCTAATAAG
GTTTTTGTTACTTGTGATGCCAGTATTATCGGGACCGGTGCCGTCTTGAGCTATGGTCCATCTTGGTCACAATCC
CGTCCCGTTGCCTTCGACTCTCAGCAATATGCTCCCCCCCAGCGTCATTACCCCACTCATGAGCAAGAGCTTCTG
GCTATTATTCGTGCACTACGCAAATGGCGACCCGACCTCCTTGGTTTGCATTTTGAGATCTATACCGATCACAAA
ACTCTTTTGAATTTTGACACTCAGAAAGATCTCTCGCGTAGGCAGGCTCGTTGGATGGAGTTTCTCTCGCAGTAC
GACTACAAAATCAACTACGTTGCTGGTGTACTTAACACAGCTGCTGATGCTCTCTCCCGTCTCCCTCATACTTCT
CCTTCATCTTCCCTCCCTGGCGATCCCCTCCTCATTGCAGCTACCTTCTTATCTTCTTCCGCGTCACTCTTTGTA
CCATCACACCCTTTACCATCTCCGCATTCAGCTTCTTCCGATTCGTCTCTATCTGTCGCTTCTCTCGTCCGACTC
GATGCTGAAAACACTCTGCTTGAGGAAGTACGTCACGGCTACCTCCTAGACCCCTTCACTGTCAAATTGAAGGAC
GCTCTCCGTCTTCATAGCACCCCCCCAAACTCCTTCCCTGAACGTGATGGGCTCTTCTTCTACCACAACCGCCTT
GTCATTCCGAACCACAACAACCTTCGCGAACGTCTCTTTTACCTTGCCCATGATCAGCTTGGCCATTTTGGATTC
GATAAATCTTACGCCAATATTCGCTCCTCTTTTTATTGGCCAAACATGCGTTCTGACTTGGAACGTTCGTACGTT
CCCTCCTGCGAGGCCTGCCAAATGAACAAATCTCCTACTACCAAGCGGGCTGGCCCACTGCATCCCCTTCCCATC
CCTGATGATCGTTTCTCCTCTGTCGCCATTGATTTCATCGGACCACTACCTGACGATAATGGTTTTGATTTCCTC
GCCACGGTTACAGACCGCCTTGGCGCAGATGTTAAACTGATACCTTGCAAGTCGTCCGTCACAGCCGAAGAATTT
GCGCAACTTTTCATCGACCACTGGATCTGTGATAATGGATGTCCTAGAGAAATCATTTCCGATCGTGACCGTCGT
TTCGTTTCGAAATTCTGGCAATCTCTTACCCAAATCCTCCAAATCAATCACATATGCTCTTCCGCCTTCCATCCA
CAAACTGATGGTGCCTCCGAACGAACGAATAAAACTGTCTTGCAGTGCCTTCGTTTTTTTGTTGATAGGAACCAG
AAGGGTTGGGTCTCTGCTCTTCCACGTGTCCGTTTCAACATTATGTCTTCCGTAAATGCATCCACATCTTTCTCT
GGCTTTCAACTGAAATCAGGTTTCTCTCCACGACCCATCCCTCCTCCTCCTTCTGTGCCGAAGAATCCTGCTGAT
GCTCTCTCTCGCGCCGCCTCTATCATCCAATCCTTCCACGATGATGTTCTCCAGGCGAAGGACAATCTATTAGCA
GCCAAGATTGTTCAAGCCCACTTTGCGAACGACTATAGATCTGAGGACCCTGGCTACAAAGTCGGCGACCGTGTT
TGGTTGAACACTTCAAACTGCCGTCGGGATTATGTCCATCGTGGTTCTGGTCGTGCCGCCAAGTTCATGCCTCGT
TTTGATGGACCTTTCTTTATCACGAAAGCTTACCCCGAATCTTCATCTTACACTCTCGACCTCCCCCTTTCTTCC
TCTATTCACCCTACTTTCCACGTTTCCCTTCTGCGACCTTTCATCCCGAACGACGACCTTAAATTTCCCAACCGC
ATTCGACCGAACCCGGAGCCAGTCCTGGTTGATGGAGAGTTTGAACATGAGATAGAAAAGATAATTGATGAAAGA
AAACGGGGTCGCGGTAAACAATACCTCGTTCGTTGGAAACATTTCAGTTCTACTGACGACGAATGGATCCCCCAC
GCTAAACTAGCCAACAACAAAGCTCTCGACGATTGGGAAAGAAGCTCAGAGCCTTGTTTATGA
Transcript >Agabi119p4|658350
ATGTATAATTTCCAACAGCTTGTTACTGCATCCATCGAGGATCTCGATGCTCAATTCGATGCCGCTCAGAATACC
GATTTCCTTGACGGGTCCTCTGACCTCACTGTCAATGCCACCTTCCCTCTGGTTTCTGGTTCTCCCATGAACTCC
GCCTTCGGTGCTTCTACCTCTTATCACGTTGATCCCACCACCTTCCAGGCTGACGACGTCTTTGCTGGTGCTGTT
ATGTACGATGATAACAACTTGCCCATGGATGATGTTCTGGATGATGACGAAATGTATGTCCTTCCTTCTACGTCC
CCACCTCCTCATGATCACTTGCTGTGGACGTGTTACGTCGACAGTCCTCATGGCCCTTCTGCTCGTGTCCAAGCC
CTCATTGATCATGGTTGTCCCACAGTATTGATTTCGAGTAATCTTGCCGATGGCTTAGACCTGCGTCGTTTGACT
CTGGGGAAACCTTTATCTCTTGCTGGTGTAGGAGGAGGAACCTTTTCTTGCACACATTTCGTGAAACTTCATGTC
CATTCCGTAGATGACACCTGGAAAGCTCAGACTGTCCGTGCCCTTGTCGTACCTCAATTGCATTTTGATTTGATC
CTTGGTCTTGAATGGCTTCGTGCAAACAAAATTATTGTTGACATGGCAGAGAATTCTGTTGTTGCCAAGGACTCT
GGTTATATTTTGCTCGATGCCTCCCTCCCTTGCCTACGACGCCCCTCATACATTCCTTCCCCTGCTGCCACAATT
GTTCGTAAAGCCACACGACATTTACCTCCTTCTTCTGTTGCGCCATCTCGTGTTGCTGCCATTACATCCTCTCGC
AACTGCTTGCGCTCTTGCCTCGTAGAACTTCAACGAACGGTCCGTCGTGTGCCTCCGAAACGTTCCACATTCCTT
TCTTTCGGGTTGATCAAGAATCGTCTCACTTCGCTGGCTTCTCTCCAAACTCATTCTACATCTCTCTCTTCCGCC
GAAGCCACCACAAAGTCAGAATTCAACGATCTTTTCCTTGACTCCCGTTCCTCTGCTAAGATACCGTTGGGACCT
GTCAACAGTGCCCTGCAGCTTGAAGACTCCAAGGCGAAGTCAGAATTCCACGATCTTTTCCCGGAGAAACTCCCC
CACGTTAGCGCCCTCCCTTGTGATGTCCGTCATCGCATCATCATCACTGCAGCCGAGAAAATCTGTGTCGGTCGT
GAATATACTTGTCCTCGGAAATGGCGAGAGGCTTGGAAAGGGCTCATTGAAGAACATCTTCAGGCTGGTAGAATT
CGGCCCTCCTCTTCCCCTTTTGCTGCTCCTTCTTTTCTCGTTCCAAAAGCCGATCCGTCTGCTACTCCACGTTGG
GTCATTGACTATCGCCGGCTTAATGCATACACCGTGCCCGACAGATACCCGCTCCCCCGCATTGACGACATTTTG
TCCGATTGTGCAAAAGGAAAGATATGGGGAAAAATCGATATGACGAACGCCTTCTTTCAAACACGTATGCACCCT
GATGACATCAAATACACTGCCTGCCGCACCCCGTTTGGCCTCTACGAATGGACTGTAATGCCTATGGGCCTTCGT
AATTCACCTTCCACTCAGCAGAGGTGTGTCACATCTGCTCTCCGTCATCTCATAGGTCATATCTGCCATGTCTAT
TTAGACGACATTGTCATCTGGTCCAACTCTCTTGAAGAACACGTTAAAAATGTGCGTTCCGTCCTTGATGCTCTT
CGCGCCAACAGCCTTCTTTGCTCTATGAAAAAGTCTGCGCTTTTCTGTGATGAAATCCTCTTTCTCGGCCATAAG
ATCTCTCGGAATGGAATAGAAGCTGATCCGGCCAAAGTCGATAAGATTCTTTCCTGGCCTATCCCCCGCAACAGC
ACTGAAGTACGACGTTTCCTCGGCCTCGTTAAATTTGTTGCACATTACCTTTCTGATCTCGCTCAACATACCCAC
ATTTTGTACCCTCTCACAACAAAGACGGCCGATAAGCATTTCCCTTCCTGGTCTACTGCTCACCAAACTGCCTTT
GATTCCATCAAACTCCTTGTCACAAGTCGGCGTTGCCTTACTACCATCAACCATGACAATCTTGGCTCTAATAAG
GTTTTTGTTACTTGTGATGCCAGTATTATCGGGACCGGTGCCGTCTTGAGCTATGGTCCATCTTGGTCACAATCC
CGTCCCGTTGCCTTCGACTCTCAGCAATATGCTCCCCCCCAGCGTCATTACCCCACTCATGAGCAAGAGCTTCTG
GCTATTATTCGTGCACTACGCAAATGGCGACCCGACCTCCTTGGTTTGCATTTTGAGATCTATACCGATCACAAA
ACTCTTTTGAATTTTGACACTCAGAAAGATCTCTCGCGTAGGCAGGCTCGTTGGATGGAGTTTCTCTCGCAGTAC
GACTACAAAATCAACTACGTTGCTGGTGTACTTAACACAGCTGCTGATGCTCTCTCCCGTCTCCCTCATACTTCT
CCTTCATCTTCCCTCCCTGGCGATCCCCTCCTCATTGCAGCTACCTTCTTATCTTCTTCCGCGTCACTCTTTGTA
CCATCACACCCTTTACCATCTCCGCATTCAGCTTCTTCCGATTCGTCTCTATCTGTCGCTTCTCTCGTCCGACTC
GATGCTGAAAACACTCTGCTTGAGGAAGTACGTCACGGCTACCTCCTAGACCCCTTCACTGTCAAATTGAAGGAC
GCTCTCCGTCTTCATAGCACCCCCCCAAACTCCTTCCCTGAACGTGATGGGCTCTTCTTCTACCACAACCGCCTT
GTCATTCCGAACCACAACAACCTTCGCGAACGTCTCTTTTACCTTGCCCATGATCAGCTTGGCCATTTTGGATTC
GATAAATCTTACGCCAATATTCGCTCCTCTTTTTATTGGCCAAACATGCGTTCTGACTTGGAACGTTCGTACGTT
CCCTCCTGCGAGGCCTGCCAAATGAACAAATCTCCTACTACCAAGCGGGCTGGCCCACTGCATCCCCTTCCCATC
CCTGATGATCGTTTCTCCTCTGTCGCCATTGATTTCATCGGACCACTACCTGACGATAATGGTTTTGATTTCCTC
GCCACGGTTACAGACCGCCTTGGCGCAGATGTTAAACTGATACCTTGCAAGTCGTCCGTCACAGCCGAAGAATTT
GCGCAACTTTTCATCGACCACTGGATCTGTGATAATGGATGTCCTAGAGAAATCATTTCCGATCGTGACCGTCGT
TTCGTTTCGAAATTCTGGCAATCTCTTACCCAAATCCTCCAAATCAATCACATATGCTCTTCCGCCTTCCATCCA
CAAACTGATGGTGCCTCCGAACGAACGAATAAAACTGTCTTGCAGTGCCTTCGTTTTTTTGTTGATAGGAACCAG
AAGGGTTGGGTCTCTGCTCTTCCACGTGTCCGTTTCAACATTATGTCTTCCGTAAATGCATCCACATCTTTCTCT
GGCTTTCAACTGAAATCAGGTTTCTCTCCACGACCCATCCCTCCTCCTCCTTCTGTGCCGAAGAATCCTGCTGAT
GCTCTCTCTCGCGCCGCCTCTATCATCCAATCCTTCCACGATGATGTTCTCCAGGCGAAGGACAATCTATTAGCA
GCCAAGATTGTTCAAGCCCACTTTGCGAACGACTATAGATCTGAGGACCCTGGCTACAAAGTCGGCGACCGTGTT
TGGTTGAACACTTCAAACTGCCGTCGGGATTATGTCCATCGTGGTTCTGGTCGTGCCGCCAAGTTCATGCCTCGT
TTTGATGGACCTTTCTTTATCACGAAAGCTTACCCCGAATCTTCATCTTACACTCTCGACCTCCCCCTTTCTTCC
TCTATTCACCCTACTTTCCACGTTTCCCTTCTGCGACCTTTCATCCCGAACGACGACCTTAAATTTCCCAACCGC
ATTCGACCGAACCCGGAGCCAGTCCTGGTTGATGGAGAGTTTGAACATGAGATAGAAAAGATAATTGATGAAAGA
AAACGGGGTCGCGGTAAACAATACCTCGTTCGTTGGAAACATTTCAGTTCTACTGACGACGAATGGATCCCCCAC
GCTAAACTAGCCAACAACAAAGCTCTCGACGATTGGGAAAGAAGCTCAGAGCCTTGTTTATGA
Gene >Agabi119p4|658350
ATGTATAATTTCCAACAGCTTGTTACTGCATCCATCGAGGATCTCGATGCTCAATTCGATGCCGCTCAGAATACC
GATTTCCTTGACGGGTCCTCTGACCTCACTGTCAATGCCACCTTCCCTCTGGTTTCTGGTTCTCCCATGAACTCC
GCCTTCGGTGCTTCTACCTCTTATCACGTTGATCCCACCACCTTCCAGGCTGACGACGTCTTTGCTGGTGCTGTT
ATGTACGATGATAACAACTTGCCCATGGATGATGTTCTGGATGATGACGAAATGTATGTCCTTCCTTCTACGTCC
CCACCTCCTCATGATCACTTGCTGTGGACGTGTTACGTCGACAGTCCTCATGGCCCTTCTGCTCGTGTCCAAGCC
CTCATTGATCATGGTTGTCCCACAGTATTGATTTCGAGTAATCTTGCCGATGGCTTAGACCTGCGTCGTTTGACT
CTGGGGAAACCTTTATCTCTTGCTGGTGTAGGAGGAGGAACCTTTTCTTGCACACATTTCGTGAAACTTCATGTC
CATTCCGTAGATGACACCTGGAAAGCTCAGACTGTCCGTGCCCTTGTCGTACCTCAATTGCATTTTGATTTGATC
CTTGGTCTTGAATGGCTTCGTGCAAACAAAATTATTGTTGACATGGCAGAGAATTCTGTTGTTGCCAAGGACTCT
GGTTATATTTTGCTCGATGCCTCCCTCCCTTGCCTACGACGCCCCTCATACATTCCTTCCCCTGCTGCCACAATT
GTTCGTAAAGCCACACGACATTTACCTCCTTCTTCTGTTGCGCCATCTCGTGTTGCTGCCATTACATCCTCTCGC
AACTGCTTGCGCTCTTGCCTCGTAGAACTTCAACGAACGGTCCGTCGTGTGCCTCCGAAACGTTCCACATTCCTT
TCTTTCGGGTTGATCAAGAATCGTCTCACTTCGCTGGCTTCTCTCCAAACTCATTCTACATCTCTCTCTTCCGCC
GAAGCCACCACAAAGTCAGAATTCAACGATCTTTTCCTTGACTCCCGTTCCTCTGCTAAGATACCGTTGGGACCT
GTCAACAGTGCCCTGCAGCTTGAAGACTCCAAGGCGAAGTCAGAATTCCACGATCTTTTCCCGGAGAAACTCCCC
CACGTTAGCGCCCTCCCTTGTGATGTCCGTCATCGCATCATCATCACTGCAGCCGAGAAAATCTGTGTCGGTCGT
GAATATACTTGTCCTCGGAAATGGCGAGAGGCTTGGAAAGGGCTCATTGAAGAACATCTTCAGGCTGGTAGAATT
CGGCCCTCCTCTTCCCCTTTTGCTGCTCCTTCTTTTCTCGTTCCAAAAGCCGATCCGTCTGCTACTCCACGTTGG
GTCATTGACTATCGCCGGCTTAATGCATACACCGTGCCCGACAGATACCCGCTCCCCCGCATTGACGACATTTTG
TCCGATTGTGCAAAAGGAAAGATATGGGGAAAAATCGATATGACGAACGCCTTCTTTCAAACACGTATGCACCCT
GATGACATCAAATACACTGCCTGCCGCACCCCGTTTGGCCTCTACGAATGGACTGTAATGCCTATGGGCCTTCGT
AATTCACCTTCCACTCAGCAGAGGTGTGTCACATCTGCTCTCCGTCATCTCATAGGTCATATCTGCCATGTCTAT
TTAGACGACATTGTCATCTGGTCCAACTCTCTTGAAGAACACGTTAAAAATGTGCGTTCCGTCCTTGATGCTCTT
CGCGCCAACAGCCTTCTTTGCTCTATGAAAAAGTCTGCGCTTTTCTGTGATGAAATCCTCTTTCTCGGCCATAAG
ATCTCTCGGAATGGAATAGAAGCTGATCCGGCCAAAGTCGATAAGATTCTTTCCTGGCCTATCCCCCGCAACAGC
ACTGAAGTACGACGTTTCCTCGGCCTCGTTAAATTTGTTGCACATTACCTTTCTGATCTCGCTCAACATACCCAC
ATTTTGTACCCTCTCACAACAAAGACGGCCGATAAGCATTTCCCTTCCTGGTCTACTGCTCACCAAACTGCCTTT
GATTCCATCAAACTCCTTGTCACAAGTCGGCGTTGCCTTACTACCATCAACCATGACAATCTTGGCTCTAATAAG
GTTTTTGTTACTTGTGATGCCAGTATTATCGGGACCGGTGCCGTCTTGAGCTATGGTCCATCTTGGTCACAATCC
CGTCCCGTTGCCTTCGACTCTCAGCAATATGCTCCCCCCCAGCGTCATTACCCCACTCATGAGCAAGAGCTTCTG
GCTATTATTCGTGCACTACGCAAATGGCGACCCGACCTCCTTGGTTTGCATTTTGAGATCTATACCGATCACAAA
ACTCTTTTGAATTTTGACACTCAGAAAGATCTCTCGCGTAGGCAGGCTCGTTGGATGGAGTTTCTCTCGCAGTAC
GACTACAAAATCAACTACGTTGCTGGTGTACTTAACACAGCTGCTGATGCTCTCTCCCGTCTCCCTCATACTTCT
CCTTCATCTTCCCTCCCTGGCGATCCCCTCCTCATTGCAGCTACCTTCTTATCTTCTTCCGCGTCACTCTTTGTA
CCATCACACCCTTTACCATCTCCGCATTCAGCTTCTTCCGATTCGTCTCTATCTGTCGCTTCTCTCGTCCGACTC
GATGCTGAAAACACTCTGCTTGAGGAAGTACGTCACGGCTACCTCCTAGACCCCTTCACTGTCAAATTGAAGGAC
GCTCTCCGTCTTCATAGCACCCCCCCAAACTCCTTCCCTGAACGTGATGGGCTCTTCTTCTACCACAACCGCCTT
GTCATTCCGAACCACAACAACCTTCGCGAACGTCTCTTTTACCTTGCCCATGATCAGCTTGGCCATTTTGGATTC
GATAAATCTTACGCCAATATTCGCTCCTCTTTTTATTGGCCAAACATGCGTTCTGACTTGGAACGTTCGTACGTT
CCCTCCTGCGAGGCCTGCCAAATGAACAAATCTCCTACTACCAAGCGGGCTGGCCCACTGCATCCCCTTCCCATC
CCTGATGATCGTTTCTCCTCTGTCGCCATTGATTTCATCGGACCACTACCTGACGATAATGGTTTTGATTTCCTC
GCCACGGTTACAGACCGCCTTGGCGCAGATGTTAAACTGATACCTTGCAAGTCGTCCGTCACAGCCGAAGAATTT
GCGCAACTTTTCATCGACCACTGGATCTGTGATAATGGATGTCCTAGAGAAATCATTTCCGATCGTGACCGTCGT
TTCGTTTCGAAATTCTGGCAATCTCTTACCCAAATCCTCCAAATCAATCACATATGCTCTTCCGCCTTCCATCCA
CAAACTGATGGTGCCTCCGAACGAACGAATAAAACTGTCTTGCAGTGCCTTCGTTTTTTTGTTGATAGGAACCAG
AAGGGTTGGGTCTCTGCTCTTCCACGTGTCCGTTTCAACATTATGTCTTCCGTAAATGCATCCACATCTTTCTCT
GGCTTTCAACTGAAATCAGGTTTCTCTCCACGACCCATCCCTCCTCCTCCTTCTGTGCCGAAGAATCCTGCTGAT
GCTCTCTCTCGCGCCGCCTCTATCATCCAATCCTTCCACGATGATGTTCTCCAGGCGAAGGACAATCTATTAGCA
GCCAAGATTGTTCAAGCCCACTTTGCGAACGACTATAGATCTGAGGACCCTGGCTACAAAGTCGGCGACCGTGTT
TGGTTGAACACTTCAAACTGCCGTCGGGATTATGTCCATCGTGGTTCTGGTCGTGCCGCCAAGTTCATGCCTCGT
TTTGATGGACCTTTCTTTATCACGAAAGCTTACCCCGAATCTTCATCTTACACTCTCGACCTCCCCCTTTCTTCC
TCTATTCACCCTACTTTCCACGTTTCCCTTCTGCGACCTTTCATCCCGAACGACGACCTTAAATTTCCCAACCGC
ATTCGACCGAACCCGGAGCCAGTCCTGGTTGATGGAGAGTTTGAACATGAGATAGAAAAGATAATTGATGAAAGA
AAACGGGGTCGCGGTAAACAATACCTCGTTCGTTGGAAACATTTCAGTTCTACTGACGACGAATGGATCCCCCAC
GCTAAACTAGCCAACAACAAAGCTCTCGACGATTGGGAAAGAAGCTCAGAGCCTTGTTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail