Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|655050
Gene name
Locationscaffold_06:31127..32335
Strand-
Gene length (bp)1208
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03443 AA9 Auxiliary Activity family 9 (formerly GH61) 1.3E-59 20 229
PF00734 CBM_1 Fungal cellulose binding domain 1.5E-12 274 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 1 305 1.0E-57
sp|Q4WBU0|EGLD_ASPFU Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglD PE=3 SV=1 1 305 1.0E-57
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 1 305 2.0E-53
sp|Q0CEU4|EGLD_ASPTN Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglD PE=3 SV=1 1 305 6.0E-53
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 3 305 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 1 305 1.0E-57
sp|Q4WBU0|EGLD_ASPFU Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglD PE=3 SV=1 1 305 1.0E-57
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 1 305 2.0E-53
sp|Q0CEU4|EGLD_ASPTN Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglD PE=3 SV=1 1 305 6.0E-53
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 3 305 5.0E-52
sp|A1C4H2|EGLD_ASPCL Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglD PE=3 SV=1 1 269 2.0E-48
sp|Q2US83|EGLD_ASPOR Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglD PE=3 SV=1 1 241 7.0E-47
sp|B8MXJ7|EGLD_ASPFN Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglD PE=3 SV=1 1 241 7.0E-47
sp|A2R5N0|EGLD_ASPNC Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglD PE=3 SV=1 20 241 1.0E-42
sp|Q96WQ9|EGLD_ASPKW Probable endo-beta-1,4-glucanase D OS=Aspergillus kawachii (strain NBRC 4308) GN=eglD PE=3 SV=1 20 241 3.0E-42
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 2 305 7.0E-34
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 47 305 2.0E-32
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 105 305 1.0E-31
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 1 241 2.0E-19
sp|P13860|GUX1_PHACH Exoglucanase 1 OS=Phanerochaete chrysosporium GN=CBH1 PE=2 SV=1 267 306 1.0E-13
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 252 305 2.0E-11
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 266 305 2.0E-10
sp|Q4U4T0|CHI2_METAN Endochitinase 2 OS=Metarhizium anisopliae GN=chi2 PE=1 SV=1 267 305 6.0E-10
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 259 306 1.0E-09
sp|P46238|GUXC_FUSOX Putative exoglucanase type C OS=Fusarium oxysporum PE=2 SV=1 265 305 2.0E-09
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 275 305 1.0E-08
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 249 305 2.0E-08
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 274 305 2.0E-08
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 266 305 3.0E-08
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 249 305 3.0E-08
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 274 305 1.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 274 305 1.0E-07
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 270 305 3.0E-07
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 275 305 4.0E-07
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 275 305 4.0E-07
sp|Q7Z9M8|XG74_HYPJQ Xyloglucanase OS=Hypocrea jecorina (strain QM6a) GN=cel74a PE=1 SV=1 264 305 6.0E-07
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 254 305 9.0E-07
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 267 305 1.0E-06
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 275 305 1.0E-06
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 273 305 1.0E-06
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 275 305 1.0E-06
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 275 305 1.0E-06
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 267 305 2.0E-06
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 275 305 2.0E-06
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 275 305 2.0E-06
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 275 305 2.0E-06
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 273 305 3.0E-06
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 275 305 4.0E-06
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 275 305 4.0E-06
sp|P38676|GUX1B_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 248 305 5.0E-06
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 270 305 7.0E-06
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 275 305 7.0E-06
sp|B8M9H9|FAEB_TALSN Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeB PE=1 SV=1 274 305 8.0E-06
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 274 305 8.0E-06
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 275 305 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030247 polysaccharide binding No
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|655050
MKSSLLASSLISLISVVFAHSIFQELHVNGVSQGHMVGIRVPDYDGPIMDVTSNDLICNGGINPYHQPVSRAVIN
VPAGAQVTAEWHHTLNGAEPNDPADPIDASHHGPVMAYMAKIPDALQSDVTGLRWFKVYHDGLSNGVWGVDRLIS
NDGKVTFTVPQCIASGQYLLRVELIALHAAGSYPGAQLYMECAQINVTGGSGSVSPSTVSIPGMYKGSDPGITIN
IYQPLSGYTIPGPSVFSCSGNNQPPSSSTATSNPQPTTSNPPTSGTVPQWGQCGGQGYTGPTTCVAPYTCHVQSP
YYSQCY*
Coding >Agabi119p4|655050
ATGAAATCGTCTCTTTTGGCTTCCTCATTGATATCACTTATTAGTGTTGTGTTCGCTCACAGTATCTTCCAGGAG
CTCCACGTCAATGGTGTCAGTCAAGGACATATGGTTGGTATCCGGGTGCCCGACTACGATGGCCCCATCATGGAT
GTCACCTCTAACGATCTGATTTGTAATGGGGGCATTAACCCTTACCACCAACCTGTGTCCCGCGCTGTTATTAAT
GTTCCTGCTGGTGCCCAGGTCACGGCTGAATGGCACCACACACTCAACGGTGCTGAGCCAAATGACCCTGCTGAT
CCAATTGACGCCTCCCACCATGGCCCAGTTATGGCTTACATGGCTAAAATACCTGACGCTCTTCAGAGTGACGTT
ACTGGACTGCGATGGTTCAAGGTTTACCATGACGGTCTTAGCAATGGTGTATGGGGAGTCGACAGATTGATTTCC
AACGACGGCAAGGTCACTTTCACCGTTCCTCAATGCATTGCATCTGGACAATACCTTCTGCGAGTTGAGCTCATT
GCTCTCCATGCTGCGGGTTCCTACCCAGGTGCTCAGCTCTATATGGAATGTGCTCAAATTAACGTGACTGGTGGT
TCGGGCTCTGTGTCGCCTTCCACAGTGAGCATCCCAGGCATGTACAAAGGATCCGACCCCGGCATCACGATCAAT
ATCTATCAACCTCTCAGCGGTTATACTATCCCAGGACCTTCTGTTTTCTCCTGCAGCGGTAATAATCAACCTCCA
TCCAGCTCAACCGCTACGAGCAACCCACAGCCCACGACCAGCAACCCCCCCACCTCTGGTACTGTACCTCAGTGG
GGTCAATGTGGTGGACAAGGCTACACCGGCCCCACCACATGTGTAGCTCCCTACACGTGCCACGTACAGAGTCCA
TACTATTCCCAGTGTTATTGA
Transcript >Agabi119p4|655050
ATGAAATCGTCTCTTTTGGCTTCCTCATTGATATCACTTATTAGTGTTGTGTTCGCTCACAGTATCTTCCAGGAG
CTCCACGTCAATGGTGTCAGTCAAGGACATATGGTTGGTATCCGGGTGCCCGACTACGATGGCCCCATCATGGAT
GTCACCTCTAACGATCTGATTTGTAATGGGGGCATTAACCCTTACCACCAACCTGTGTCCCGCGCTGTTATTAAT
GTTCCTGCTGGTGCCCAGGTCACGGCTGAATGGCACCACACACTCAACGGTGCTGAGCCAAATGACCCTGCTGAT
CCAATTGACGCCTCCCACCATGGCCCAGTTATGGCTTACATGGCTAAAATACCTGACGCTCTTCAGAGTGACGTT
ACTGGACTGCGATGGTTCAAGGTTTACCATGACGGTCTTAGCAATGGTGTATGGGGAGTCGACAGATTGATTTCC
AACGACGGCAAGGTCACTTTCACCGTTCCTCAATGCATTGCATCTGGACAATACCTTCTGCGAGTTGAGCTCATT
GCTCTCCATGCTGCGGGTTCCTACCCAGGTGCTCAGCTCTATATGGAATGTGCTCAAATTAACGTGACTGGTGGT
TCGGGCTCTGTGTCGCCTTCCACAGTGAGCATCCCAGGCATGTACAAAGGATCCGACCCCGGCATCACGATCAAT
ATCTATCAACCTCTCAGCGGTTATACTATCCCAGGACCTTCTGTTTTCTCCTGCAGCGGTAATAATCAACCTCCA
TCCAGCTCAACCGCTACGAGCAACCCACAGCCCACGACCAGCAACCCCCCCACCTCTGGTACTGTACCTCAGTGG
GGTCAATGTGGTGGACAAGGCTACACCGGCCCCACCACATGTGTAGCTCCCTACACGTGCCACGTACAGAGTCCA
TACTATTCCCAGTGTTATTGA
Gene >Agabi119p4|655050
ATGAAATCGTCTCTTTTGGCTTCCTCATTGATATCACTTATTAGTGTTGTGTTCGCTCACAGTATCTTCCAGGAG
CTCCACGTCAATGGTGTCAGTCAAGGACATATGGTTGGTATCCGGGTGCCCGACTACGATGGCGTAAGTCCTGCC
TTGTTCGCTATTCCTCACAGATGAAAAATATATCTTTTTCAGCCCATCATGGATGTCACCTCTAACGATCTGATT
TGTAATGGGGGCATTAACCCTTACCACCAACCTGTGTCCCGCGCTGTTATTAATGTTCCTGCTGGTGCCCAGGTC
ACGGCTGAATGGCACCACACACTCAACGGTGCTGAGCCAAATGACCCTGCTGATCCAATTGACGCCTCCCACCAT
GGCCCAGTTATGGCTTACATGTAAGATTGCACTGAACTACTCTATCATTCAGGGGCAGAATGTTCACAGATCCAA
TTTTCTAGGGCTAAAATACCTGACGCTCTTCAGAGTGACGTTACTGGACTGCGATGGTTCAAGGTTTACCATGAC
GGTCTTAGCAATGGTGTATGGGGAGTCGACAGATTGATTTCCAACGACGGCAAGGTCACTTTCACCGTTCCTCAA
TGCATTGCATCTGGACAATACCTTCTGCGAGTTGAGCTCATTGCTCTCCATGCTGCGGGTTCCTACCCAGGTGCT
CAGCTCTATGTTCGTTGTACTATATCAGCTGCCGATAACCGAGTTTGCTGACACCTCAAAACAGATGGAATGTGC
TCAAATTAACGTGACTGGTGGTTCGGGCTCTGTGTCGCCTTCCACAGTGAGCATCCCAGGCATGTACAAAGGTAA
GCGTTTTTTTCCATGGTCAAAGCGAACGACAATGCATGACAAATTATCAAGGATCCGACCCCGGCATCACGATCA
ATATCTATCAACCTCTCAGCGGTTATACTATCCCAGGACCTTCTGTTTTCTCCTGCAGCGGTAATAATCAACCTC
CATCCAGCTCAACCGCTACGAGCAACCCACAGCCCACGACCAGCAACCCCCCCACCTCTGGTACTGTACCTCAGT
GGGGTCAATGTGGTGGACAAGGCTACACCGGCCCCACCACATGTGTAGCTCCCTACACGTGCCACGTACAGAGTC
CATACGTATGTCGATGTTATTCCATTTTTTCCCACTGGATTTGACTGATACGCGTTCCTTTTCAGTATTCCCAGT
GTTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail