Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|648000
Gene name
Locationscaffold_05b:33155..35788
Strand-
Gene length (bp)2633
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07969 Amidohydro_3 Amidohydrolase family 1.5E-74 85 590

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34355|YTCJ_BACSU Putative amidohydrolase YtcJ OS=Bacillus subtilis (strain 168) GN=ytcJ PE=4 SV=1 84 590 1.0E-47
sp|Q68AP4|NFDA_ARTPS N-substituted formamide deformylase OS=Arthrobacter pascens GN=nfdA PE=1 SV=1 23 593 1.0E-25
sp|Q06555|AEPA_PECCC Exoenzymes regulatory protein AepA OS=Pectobacterium carotovorum subsp. carotovorum GN=aepA PE=3 SV=1 23 439 6.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|648000
MHSTNALYGLSSPLTEYTVCSSSSRIYTVSELQPQAQCITIKNDRIVYLGKHDDVVSSTVNVPLLNWKIPFRWPS
VSFVDPTDIIVPGLADAHAHVLENGWMMQLPLGGSRSVEEIVERVKSYIHDHPDVLHDQDRWIEGMGWDQTRWQN
EEFPKAADLDQAPLLKGRPIVLSRVDGHARWVSPRVLEIMGTLPEDSEIVGGQIIRDSQGHPTGVFVDNAMILIP
ISPWTHNQMEEYFSATANLALQYGLTSIHDAQTKIPMVEFFQKKADEGAIPLRLYLMGSVALHGNNSDSDAAETA
AYIDSDWKHGIPRFVNYGKQGRLTLRSVKLFADGALGSWGAAMLAPYSDNPDLQGTLLQAPEVLRAAVRRFWEDD
MQVNVHCIGDKANRITLDIFEELIREQDINVSSWRPRIEHAQIINRHDLDRFGKLGVTASVQPTHATSDMWYAES
RLGPDRMEGAYAYATLLWVSGDKMLPLGSDFPVEGVNPLLGFYAAVKRLAVDGSSPHGPSGWFPNERLTRREALK
GMTLDPAYASFQEQDIGSLKIGKKADFVVFDRDFVDCGYEEEASCNGSEILEAKVKTVVIDGRVVRGELPQPKDN
VTFWGIISKLGTYVRATGLL*
Coding >Agabi119p4|648000
ATGCACTCAACCAACGCCTTGTATGGGTTGTCATCTCCGCTCACGGAATACACGGTTTGTTCAAGCTCGAGTCGC
ATCTACACCGTGAGCGAGCTACAGCCACAAGCCCAATGTATAACCATCAAAAATGACCGCATCGTATATCTTGGA
AAGCACGATGACGTTGTCTCGTCTACGGTTAATGTTCCGCTGCTGAACTGGAAGATACCATTCAGGTGGCCTTCA
GTTTCCTTTGTGGATCCTACAGATATCATTGTGCCTGGATTAGCTGACGCTCACGCTCACGTCCTTGAAAATGGT
TGGATGATGCAGCTACCACTTGGAGGCTCTAGATCGGTTGAAGAAATTGTTGAACGCGTCAAAAGCTATATCCAC
GATCATCCCGATGTACTGCATGACCAAGACCGCTGGATTGAAGGCATGGGATGGGACCAAACCAGGTGGCAAAAC
GAAGAGTTTCCGAAAGCGGCAGACCTCGATCAAGCTCCCCTTCTAAAAGGACGTCCAATTGTCCTCAGTCGGGTG
GATGGGCATGCTCGATGGGTTTCTCCACGCGTACTCGAAATCATGGGCACTTTACCGGAAGACAGCGAAATTGTA
GGTGGACAAATCATCCGAGACTCTCAGGGACATCCAACTGGGGTCTTCGTCGACAACGCGATGATTCTTATTCCG
ATTTCTCCTTGGACCCATAATCAAATGGAAGAATACTTTTCGGCGACTGCGAATCTTGCTTTACAATACGGGCTT
ACTAGCATCCATGATGCTCAAACCAAAATACCCATGGTTGAATTTTTTCAAAAGAAAGCTGACGAAGGCGCTATT
CCTCTACGTTTATACCTCATGGGAAGCGTTGCGTTGCACGGCAACAATTCTGACTCCGACGCGGCTGAAACTGCA
GCATACATTGATAGCGACTGGAAGCACGGCATTCCTCGGTTCGTCAACTACGGGAAACAAGGCCGTCTCACTCTG
CGAAGCGTGAAACTATTTGCGGATGGCGCTCTAGGATCGTGGGGTGCAGCCATGCTAGCTCCGTACTCAGACAAT
CCTGACCTCCAGGGTACTCTACTGCAGGCTCCTGAAGTCTTGCGAGCGGCTGTTCGAAGGTTCTGGGAAGACGAT
ATGCAAGTTAATGTCCATTGTATCGGAGATAAAGCGAACCGCATTACTCTTGACATCTTTGAAGAACTAATTCGA
GAGCAAGATATAAACGTTTCTTCGTGGAGGCCACGCATTGAACACGCCCAAATCATTAACAGACATGATCTTGAC
CGTTTCGGGAAGCTGGGAGTGACTGCCAGTGTGCAGCCAACACATGCGACATCTGATATGTGGTATGCCGAGAGT
CGATTGGGTCCAGACCGAATGGAAGGCGCTTATGCGTATGCTACGTTACTGTGGGTCTCAGGTGACAAAATGCTC
CCTCTTGGATCAGACTTCCCTGTTGAAGGTGTGAACCCACTTCTCGGATTCTATGCCGCAGTCAAGCGCCTCGCA
GTAGACGGATCTTCTCCGCATGGTCCTTCTGGATGGTTCCCTAACGAACGGCTGACGAGAAGAGAAGCACTCAAG
GGGATGACTCTAGACCCAGCGTATGCATCGTTCCAGGAGCAGGATATTGGTTCTCTCAAAATAGGAAAGAAGGCT
GACTTTGTGGTTTTTGATCGGGACTTTGTGGATTGCGGGTACGAAGAAGAAGCAAGTTGTAATGGGTCCGAGATC
TTGGAGGCAAAGGTGAAAACAGTCGTCATTGACGGAAGGGTGGTGCGGGGTGAGTTACCTCAACCTAAGGACAAT
GTTACGTTTTGGGGTATCATAAGCAAGTTGGGGACATATGTACGAGCGACAGGTCTGTTGTAG
Transcript >Agabi119p4|648000
ATGCACTCAACCAACGCCTTGTATGGGTTGTCATCTCCGCTCACGGAATACACGGTTTGTTCAAGCTCGAGTCGC
ATCTACACCGTGAGCGAGCTACAGCCACAAGCCCAATGTATAACCATCAAAAATGACCGCATCGTATATCTTGGA
AAGCACGATGACGTTGTCTCGTCTACGGTTAATGTTCCGCTGCTGAACTGGAAGATACCATTCAGGTGGCCTTCA
GTTTCCTTTGTGGATCCTACAGATATCATTGTGCCTGGATTAGCTGACGCTCACGCTCACGTCCTTGAAAATGGT
TGGATGATGCAGCTACCACTTGGAGGCTCTAGATCGGTTGAAGAAATTGTTGAACGCGTCAAAAGCTATATCCAC
GATCATCCCGATGTACTGCATGACCAAGACCGCTGGATTGAAGGCATGGGATGGGACCAAACCAGGTGGCAAAAC
GAAGAGTTTCCGAAAGCGGCAGACCTCGATCAAGCTCCCCTTCTAAAAGGACGTCCAATTGTCCTCAGTCGGGTG
GATGGGCATGCTCGATGGGTTTCTCCACGCGTACTCGAAATCATGGGCACTTTACCGGAAGACAGCGAAATTGTA
GGTGGACAAATCATCCGAGACTCTCAGGGACATCCAACTGGGGTCTTCGTCGACAACGCGATGATTCTTATTCCG
ATTTCTCCTTGGACCCATAATCAAATGGAAGAATACTTTTCGGCGACTGCGAATCTTGCTTTACAATACGGGCTT
ACTAGCATCCATGATGCTCAAACCAAAATACCCATGGTTGAATTTTTTCAAAAGAAAGCTGACGAAGGCGCTATT
CCTCTACGTTTATACCTCATGGGAAGCGTTGCGTTGCACGGCAACAATTCTGACTCCGACGCGGCTGAAACTGCA
GCATACATTGATAGCGACTGGAAGCACGGCATTCCTCGGTTCGTCAACTACGGGAAACAAGGCCGTCTCACTCTG
CGAAGCGTGAAACTATTTGCGGATGGCGCTCTAGGATCGTGGGGTGCAGCCATGCTAGCTCCGTACTCAGACAAT
CCTGACCTCCAGGGTACTCTACTGCAGGCTCCTGAAGTCTTGCGAGCGGCTGTTCGAAGGTTCTGGGAAGACGAT
ATGCAAGTTAATGTCCATTGTATCGGAGATAAAGCGAACCGCATTACTCTTGACATCTTTGAAGAACTAATTCGA
GAGCAAGATATAAACGTTTCTTCGTGGAGGCCACGCATTGAACACGCCCAAATCATTAACAGACATGATCTTGAC
CGTTTCGGGAAGCTGGGAGTGACTGCCAGTGTGCAGCCAACACATGCGACATCTGATATGTGGTATGCCGAGAGT
CGATTGGGTCCAGACCGAATGGAAGGCGCTTATGCGTATGCTACGTTACTGTGGGTCTCAGGTGACAAAATGCTC
CCTCTTGGATCAGACTTCCCTGTTGAAGGTGTGAACCCACTTCTCGGATTCTATGCCGCAGTCAAGCGCCTCGCA
GTAGACGGATCTTCTCCGCATGGTCCTTCTGGATGGTTCCCTAACGAACGGCTGACGAGAAGAGAAGCACTCAAG
GGGATGACTCTAGACCCAGCGTATGCATCGTTCCAGGAGCAGGATATTGGTTCTCTCAAAATAGGAAAGAAGGCT
GACTTTGTGGTTTTTGATCGGGACTTTGTGGATTGCGGGTACGAAGAAGAAGCAAGTTGTAATGGGTCCGAGATC
TTGGAGGCAAAGGTGAAAACAGTCGTCATTGACGGAAGGGTGGTGCGGGGTGAGTTACCTCAACCTAAGGACAAT
GTTACGTTTTGGGGTATCATAAGCAAGTTGGGGACATATGTACGAGCGACAGGTCTGTTGTAG
Gene >Agabi119p4|648000
ATGCACTCAACCAACGCCTTGTATGGGTTGTCATCTCCGCTCACGGAATACACGGTTTGTTCAAGCTCGAGTCGC
ATCTACACCGTGAGCGAGCTACAGCCACAAGCCCAATGTATAACCATCAAAAATGACCGCATCGTATATCTTGGA
AAGCACGGTATGTTATACGCTTAGTGGAGCTGGAGCCATATACTGATCTCCTCAAAGATGACGTTGTCTCGTCTA
CGGTTAATGTTCCGCTGCTGAACTGGAAGATACCATTCAGGTGGCCTTCAGTTTCCTTTGTGGATCCTACAGATA
TCATTGTGCCTGGATTAGCTGGTCAGGCCTTAAAATTTATCTGCGGGAACCACGTTCATGTTGCGTTCTAGACGC
TCACGCTCACGTCCTTGAAAATGGTTGGATGATGCAGCTACCACTTGGAGGCTCTAGATCGGTTGAAGGTAATTA
AGGTGTTTTCTTGCTATGGCAGCGAACATGACTGAAGTCGGTGCTGAAGAAATTGTTGAACGCGTCAAAAGCTAT
ATCCACGATCATCCCGATGTACTGCATGACCAAGACCGCTGGATTGAAGGCATGGGATGGGACCAAACCAGGTGG
CAAAACGAAGAGTTTCCGAAAGCGGTACGCGCCTTCTCTTTCGTAGTTGCACCAAAGGTTCAAATTTTCTCTAGG
CAGACCTCGATCAAGCTCCCCTTCTAAAAGGACGTCCAATTGTCCTCAGTCGGGTGGATGGGCATGCTCGATGGG
TTTCTCCACGCGTACTCGAAATCATGGGCACTTTACCGGAAGACAGCGAAATTGTAGGTGGACAAATCATCCGAG
ACTCTCAGGGACATCCAACTGGTGAGCCCTTAAACTGCTATCAGTCATCAATGCCATGGTCTACCTGAACTTTCT
TCTCCCTAGGGGTCTTCGTCGACAACGCGATGATTCTTATTCCGATTTCTCCTTGGACCCATAATCAAATGGAAG
AATACTTTTCGGCGACTGCGAATCTTGCTTTACAATACGGGCTTACTAGCATCCATGATGCTCAAACCAAAATAC
CCATGGTTGAATTTTTTCAAAAGTCCGTTCTCTTCGACCTCAAATTCTGCATCATTTGACTGCACTGACAGGAAA
GCTGACGAAGGCGCTATTCCTGTGTGCTCGTAATCATGCTCAATATATAAGTATCACTAATTTTGCCATAGCTAC
GTTTATACCTCATGGGAAGCGTTGCGTTGCACGGCAACAATTCTGACTCCGACGCGGCTGAAACTGCAGCATACA
TTGATAGCGACTGGAAGCACGGCATTCCTCGGTTCGTCAACTACGGGAAACAAGGCCGTCTCACTCTGCGAAGCG
TGAAACTATTTGCGGATGGTACGCATCCGCCACACTACGTCTTTCAACGATATAATCAACTTGTGTACTAGGCGC
TCTAGGATCGTGGGGTGCAGCCATGCTAGCTCCGTACTCAGACAATCCTGACCTCCAGGGTACTCTACTGCAGGC
TCCTGAAGTCTTGCGAGCGGCTGTTCGAAGGTTCTGGGAAGACGATATGCAAGTTGTATGCCCACGTCTCTGCAA
CTGTTGTCCTCGGACTAGTCTTAATCTCGTAACAGAATGTCCATTGTATCGGAGATAAAGCGAACCGCATTACTC
TTGACATCTTTGAAGAACTAATTCGAGAGCAAGATATAAACGTTTCTTCGTGGAGGCCACGCATTGAACACGCCC
AAATCATTAACAGACATGATCTTGACCGTTTCGGGAAGCTGGGAGGTACGTTTTCATTGTAATATCACAAGTGCC
GAGAAAATTGATCCAGATTTCCAGTGACTGCCAGTGTGCAGCCAACACATGCGTAAAGCTTACAACCAATTTTAG
AAGTTTATCTCAAACTGACGCTCGGACAGGACATCTGATATGTGGTATGCCGAGAGTCGATTGGTAAGTTCCACG
AGGCAAATGCACGACCTTACTCCAATTTTTCATCATAGGGTCCAGACCGAATGGAAGGCGCTTATGCGTATGCTA
CGTTACTGTGGTCAGTAGCAGCGCTTGGGCGGATATCTAAAAACACTTTTTGAACAAAGAAGCAGGGTCTCAGGT
GACAAAATGCTCCCTCTTGGATCAGACTTCCCTGTTGAAGGTGTGAACCCACTTCTCGGATTCTATGCCGCAGTC
AAGCGCCTCGCAGTAGACGGATCTTCTCCGCATGGTCCTTCTGGATGGTAAGCTCTTGTTCCGGCATCACCCAGG
TGACGTGCAACTTGGTGAAATGCTAAACGTCTATATTTGTTATCAAATGGTATAGGTTCCCTAACGAACGGCTGA
CGAGAAGAGAAGCACTCAAGGGGATGACTCTAGACCCAGCGTATGCATCGTTCCAGGAGCAGGATATTGGTTCTC
TCAAAATAGGAAAGAAGGCTGACTTTGTGGTTTTTGATCGGGACTTTGTGGATTGCGGGTACGAAGAAGAAGCAA
GTTGTAATGGGTCCGAGATCTTGGAGGCAAAGGTGAAAACAGTCGTCATTGACGGAAGGGTGGTGCGGGGTGAGT
TACCTCAACCTAAGGACAATGTTACGTTTTGGGGTATCATAAGCAAGTTGGGGACATATGTACGAGCGACAGGTC
TGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail