Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|644750
Gene name
Locationscaffold_05a:1092032..1092875
Strand+
Gene length (bp)843
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 2.9E-10 138 194

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 95 194 1.0E-14
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 108 194 1.0E-12
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 109 191 7.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|644750
MKGVIITSLLLVLRLPLRPLQFLLREASSTFTTSSIDSSITPPTAGAPLEPPHVPRRTGRVWKPPGQWWKLKQPD
LAGNDSDSDDEAALLADSEYCEVEFAGAVSGADPRSYRLAMKSPDSDCWTEACNTEIFNLEANGTWELMELPPGK
KVVNSGWVFKVKRLADGSIERYRARLVAKGYSQRPGFDFTEYISILLVRRVSRHVPAAFYYSPVTEALNNSILRK
RIQRDEVKRYQERKKKPKPKQNKSRH*
Coding >Agabi119p4|644750
ATGAAGGGGGTGATAATCACTTCCCTCCTGCTCGTCCTAAGACTCCCACTCCGTCCGCTTCAGTTCCTCCTGAGA
GAAGCCAGTTCTACCTTTACCACCTCTTCCATTGATTCCTCCATCACTCCTCCTACTGCCGGAGCGCCGCTTGAG
CCCCCTCACGTTCCTAGACGTACTGGGCGAGTTTGGAAGCCTCCTGGTCAGTGGTGGAAGCTCAAACAACCAGAC
TTAGCTGGTAATGACTCTGACTCTGATGACGAAGCTGCTCTGCTAGCTGACTCTGAGTATTGTGAAGTCGAGTTT
GCTGGAGCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACT
GAGGCTTGTAACACTGAGATATTCAATCTCGAGGCTAACGGAACTTGGGAACTAATGGAACTGCCTCCTGGCAAG
AAGGTAGTCAACTCTGGCTGGGTGTTCAAAGTGAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCTCGT
CTCGTTGCTAAAGGCTATTCCCAACGTCCCGGATTCGACTTTACCGAGTATATTTCAATACTACTCGTACGTCGG
GTGTCACGACACGTTCCCGCGGCTTTCTACTACTCGCCAGTTACAGAGGCCCTAAACAACAGTATTCTACGCAAA
CGTATCCAGCGCGACGAGGTCAAGCGCTATCAAGAGAGAAAAAAGAAACCGAAACCGAAACAAAACAAATCGAGA
CATTGA
Transcript >Agabi119p4|644750
ATGAAGGGGGTGATAATCACTTCCCTCCTGCTCGTCCTAAGACTCCCACTCCGTCCGCTTCAGTTCCTCCTGAGA
GAAGCCAGTTCTACCTTTACCACCTCTTCCATTGATTCCTCCATCACTCCTCCTACTGCCGGAGCGCCGCTTGAG
CCCCCTCACGTTCCTAGACGTACTGGGCGAGTTTGGAAGCCTCCTGGTCAGTGGTGGAAGCTCAAACAACCAGAC
TTAGCTGGTAATGACTCTGACTCTGATGACGAAGCTGCTCTGCTAGCTGACTCTGAGTATTGTGAAGTCGAGTTT
GCTGGAGCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACT
GAGGCTTGTAACACTGAGATATTCAATCTCGAGGCTAACGGAACTTGGGAACTAATGGAACTGCCTCCTGGCAAG
AAGGTAGTCAACTCTGGCTGGGTGTTCAAAGTGAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCTCGT
CTCGTTGCTAAAGGCTATTCCCAACGTCCCGGATTCGACTTTACCGAGTATATTTCAATACTACTCGTACGTCGG
GTGTCACGACACGTTCCCGCGGCTTTCTACTACTCGCCAGTTACAGAGGCCCTAAACAACAGTATTCTACGCAAA
CGTATCCAGCGCGACGAGGTCAAGCGCTATCAAGAGAGAAAAAAGAAACCGAAACCGAAACAAAACAAATCGAGA
CATTGA
Gene >Agabi119p4|644750
ATGAAGGGGGTGATAATCACTTCCCTCCTGCTCGTCCTAAGACTCCCACTCCGTCCGCTTCAGTTCCTCCTGAGA
GAAGCCAGTTCTACCTTTACCACCTCTTCCATTGATTCCTCCAGTAATTCCTCCAGTCACTCCTCCACAAATCCA
TGCACCACTCCCAGTCACTCCTCCTACTGCCGGAGCGCCGCTTGAGCCCCCTCACGTTCCTAGACGTACTGGGCG
AGTTTGGAAGCCTCCTGGTCAGTGGTGGAAGCTCAAACAACCAGACTTAGCTGGTAATGACTCTGACTCTGATGA
CGAAGCTGCTCTGCTAGCTGACTCTGAGTATTGTGAAGTCGAGTTTGCTGGAGCCGTTTCGGGTGCTGATCCCCG
GAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACTGAGGCTTGTAACACTGAGATATTCAATCT
CGAGGCTAACGGAACTTGGGAACTAATGGAACTGCCTCCTGGCAAGAAGGTAGTCAACTCTGGCTGGGTGTTCAA
AGTGAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCTCGTCTCGTTGCTAAAGGCTATTCCCAACGTCC
CGGATTCGACTTTACCGAGGTCTTTTTTTTTTTTTTTTTTTTTTTTTGTAATCAATATAGTATATTTCAATACTA
CTCGTACGTCGGGTGTCACGACACGTTCCCGCGGCTTTCTACTACTCGCCAGTTACAGAGGCCCTAAACAACAGT
ATTCTACGCAAACGTATCCAGCGCGACGAGGTCAAGCGCTATCAAGAGAGAAAAAAGAAACCGAAACCGAAACAA
AACAAATCGAGACATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail