Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|643250
Gene name
Locationscaffold_05a:1015554..1020019
Strand+
Gene length (bp)4465
Transcript length (bp)4392
Coding sequence length (bp)4392
Protein length (aa) 1464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 2.8E-38 821 923
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 2.0E-37 793 889
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 4.2E-19 568 727
PF17921 Integrase_H2C2 Integrase zinc binding domain 4.9E-19 1037 1093
PF00665 rve Integrase core domain 1.6E-09 1111 1207
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 1.0E-09 1407 1456
PF03732 Retrotrans_gag Retrotransposon gag protein 6.6E-08 143 214
PF00098 zf-CCHC Zinc knuckle 5.7E-05 322 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 486 1383 2.0E-141
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 486 1383 2.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 486 1383 2.0E-141
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 486 1383 2.0E-141
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 486 1383 6.0E-141
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 486 1383 6.0E-141
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 486 1383 1.0E-140
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 531 1391 3.0E-132
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 531 1393 2.0E-131
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 504 1264 6.0E-85
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 504 1267 9.0E-85
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 405 944 1.0E-66
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 504 943 1.0E-58
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 526 944 4.0E-55
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 526 943 1.0E-39
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 526 943 2.0E-39
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 524 941 2.0E-39
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 526 943 4.0E-39
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 526 943 5.0E-39
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 526 943 2.0E-38
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 526 943 1.0E-37
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 533 945 9.0E-33
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 498 943 8.0E-32
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 498 943 1.0E-31
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 561 949 5.0E-30
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 406 938 3.0E-29
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 1023 1361 8.0E-28
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 406 938 5.0E-27
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 964 1357 1.0E-26
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 1020 1290 7.0E-25
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 1028 1288 2.0E-24
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 526 924 2.0E-23
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 509 943 2.0E-23
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 559 897 2.0E-23
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 406 931 2.0E-23
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 524 873 3.0E-23
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 524 873 3.0E-23
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 524 873 3.0E-23
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 1029 1290 3.0E-23
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 514 943 3.0E-23
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 994 1288 4.0E-23
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 524 873 4.0E-23
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 524 977 5.0E-23
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 1028 1288 5.0E-23
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 522 873 7.0E-23
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 524 873 8.0E-23
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 524 924 2.0E-22
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 554 943 2.0E-22
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 524 873 2.0E-22
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 526 856 3.0E-22
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 524 873 6.0E-22
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 481 878 4.0E-20
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 512 877 1.0E-19
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 512 877 7.0E-19
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 1044 1316 2.0E-18
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 561 772 3.0E-18
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 574 670 4.0E-18
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 1132 1352 2.0E-17
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 512 877 3.0E-17
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 1132 1352 4.0E-17
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 1132 1352 4.0E-17
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 1132 1352 6.0E-17
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 1108 1352 8.0E-17
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 1132 1352 1.0E-16
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 1132 1352 1.0E-16
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 1132 1352 1.0E-16
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 1117 1352 1.0E-16
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 1132 1352 2.0E-16
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 1132 1352 2.0E-16
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 1003 1352 2.0E-16
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 1018 1312 2.0E-16
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 1027 1379 4.0E-16
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 1018 1267 6.0E-16
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 1018 1312 6.0E-16
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 1018 1312 8.0E-16
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 700 832 1.0E-15
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 1018 1267 1.0E-14
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 512 877 2.0E-14
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 512 879 3.0E-14
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 1001 1352 6.0E-14
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 1040 1267 7.0E-13
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 1001 1235 2.0E-12
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 1027 1259 2.0E-11
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 731 856 6.0E-11
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 1029 1267 8.0E-11
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 1043 1259 7.0E-09
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 731 856 1.0E-08
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 1025 1252 5.0E-08
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 535 783 5.0E-08
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 535 783 7.0E-08
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 535 813 8.0E-08
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 535 780 8.0E-08
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 1054 1339 1.0E-07
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 535 808 1.0E-07
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey sarcoma virus GN=pol PE=3 SV=1 1109 1267 2.0E-07
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 291 346 3.0E-07
sp|P05892|GAG_SIVVT Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag PE=3 SV=1 294 338 3.0E-07
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 294 359 4.0E-07
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 544 783 4.0E-07
sp|P27972|GAG_SIVV1 Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag PE=3 SV=1 294 338 6.0E-07
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 291 339 7.0E-07
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 291 339 8.0E-07
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 291 341 9.0E-07
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 289 344 1.0E-06
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 288 349 1.0E-06
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 294 336 1.0E-06
sp|P27978|GAG_SIVVG Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag PE=3 SV=1 294 338 1.0E-06
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 535 783 2.0E-06
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 231 342 3.0E-06
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 295 336 4.0E-06
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 291 342 4.0E-06
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 295 336 8.0E-06
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 295 336 8.0E-06
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 295 336 8.0E-06
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 295 336 8.0E-06
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 295 336 8.0E-06
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 295 336 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0015074 DNA integration Yes
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046872 metal ion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|643250
MSTERNDYDSLDEEHYERVARSTRRNQNRKNQKKRHQVDFRSYRDTRNIDTESENENTIDTDDQNNRDNNNMSND
AAVTVSAQTDALKSLIPNPKDFGGNREQFSEWWRSMTLFLKYNKVTDTDQKIIATIVRLKGPVPSCFADIWTEKI
ATNFTYTWDTFEEELKTSFGKGNEKDIAEERIESLKQGNRNTMDFLVEFTALMYKAKIDDQHAIFLLKRHTRHDI
IKTILGYPSKDIPKSREDWNNAILQVGSGLETMKRIDQKTDTGITYGGSGQPMEIGWKKFEWDKDGKPKCHKCGK
FGHIGKNCEEKRKNFGERKNFKCFSCGKFGHIAKDCRSNRSGRIRAMNEDSDDEDDSKKEQGFSDGSESARAGSK
TPPHYNKRKETQTLSHDITKFVKMDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEIDWKQGIIKFNRCPT
SCSFPHTDISFEPRIRRLQSNEDTEEKEPDPTNPEDLPAYMKPFAHLFNKKNFDKLPERTEWDHEINFTENAPTE
ISSKVYSMTPLEREELDKFLDENLATNRIRPSKSPYAAPCFFVPKKDGSLRLCQDYRKLNDITIKDKTPLPLISE
VLDQLKDAKVFNKLDIIWGYNNVRIREGDEWKAAFLTNRGLFEPTVMFFGMSNSPATFSRMMATIFREMIQDGSL
ANYMDDFIIPAKDEEELEARTIRFLKMAEKHNLSFKRTKCEFNVSSTTVLGTVIGNGKATMEEEKVKAIRDWAVP
TTVKQVESFLGFANFYRRFIKNFSTIAQPLNELKSKKGEKWYWNDEQQQAFEQIKQAIASEPVLALPKDKGQFRV
EVDASNYGTGAVLSQKQENKWHPVAFMSKTLSEAERNYEIYDKELLAIIKALKLWRHYLLDAKEQFEIWTDHENL
KYFREPQKLNARQARWYLMLQEYDFLLRHIPGKTNTKADILSRLIKPDTSNDNRGVEMFKEKMFIRRLEESTPIY
DVTLLHNRRFEILADKTVLEKIRKCERRETRVLEEMKKQPEKVWENKGIIYRQGRIYVPDNQEIRDFILHDHHNS
PDAGHPGTYRMLESVKRTFWWPTIKTDIRRYVKGCDMCQKNKTIRRPDHIPLNPLPIPDKPWEEISIDMIGPLPK
SKEKDAIIVIVDRFSKMIHLVPTTTSLTSMDLAEIYKEEVWRHHGIPKRIISNRGPQFASKFMESLCKALGIERN
LSTAYHPQTDGQTERMNQEIETYLRAFINYRQDDWTRWLPMAEFHYNDKTHAATGQTPFFLNYGLHPWKGNITVE
TTNPTATSLIEELENVREEAKAAMEINNEMMRERGNNKHHKEPFAKGDRVWLETTNIHSNRPTRKLDHKRYGPFE
ILKQIGDRSYKLKLPDTWAIHDVFHTSLLTKVRDPEFNSQKKPTPPPPDIINEEEEYEVEEIRGHRRRGRGIQFL
VHWKGYGNEDDSWIPQSSLENAEEALSEYKAKLPNGKL*
Coding >Agabi119p4|643250
ATGAGCACAGAGAGAAACGACTACGACAGTCTAGACGAAGAACACTACGAACGAGTAGCCAGATCTACTAGGAGG
AACCAGAACAGGAAGAACCAGAAGAAACGACACCAGGTTGATTTTAGGAGTTACCGAGACACTAGGAACATCGAC
ACAGAGTCAGAGAACGAGAATACCATCGACACAGACGATCAAAACAACCGAGACAACAACAACATGAGCAACGAC
GCCGCCGTAACCGTTAGTGCACAGACAGATGCACTCAAATCGCTTATCCCGAACCCGAAGGATTTTGGGGGGAAT
AGAGAGCAGTTTTCAGAATGGTGGAGGAGCATGACGCTTTTCCTCAAGTACAACAAAGTCACGGACACCGACCAG
AAGATTATCGCTACCATCGTACGATTGAAAGGACCAGTCCCCAGCTGTTTTGCCGACATATGGACAGAAAAAATC
GCCACCAACTTCACATACACTTGGGATACTTTTGAAGAAGAACTCAAGACTTCATTTGGAAAGGGAAACGAGAAG
GATATAGCAGAAGAAAGGATTGAATCCCTCAAACAAGGAAACAGGAACACCATGGACTTCCTAGTCGAATTCACA
GCTCTCATGTACAAAGCCAAAATCGATGACCAACACGCCATATTCCTCCTTAAACGCCACACTCGTCACGACATT
ATCAAAACGATCTTAGGATATCCAAGTAAAGACATTCCGAAGTCGAGAGAAGACTGGAATAACGCAATTCTACAA
GTTGGGTCAGGATTAGAGACGATGAAAAGGATTGATCAGAAGACCGATACTGGAATCACTTACGGAGGAAGTGGA
CAACCAATGGAGATAGGATGGAAGAAATTCGAATGGGACAAGGATGGAAAACCCAAATGTCACAAATGCGGAAAG
TTCGGACACATCGGGAAGAACTGCGAAGAGAAGAGGAAGAATTTTGGAGAGAGGAAGAACTTCAAGTGTTTCAGT
TGTGGGAAATTTGGACACATTGCGAAGGATTGTCGAAGCAACAGGAGTGGAAGGATTAGAGCAATGAACGAGGAT
TCTGACGATGAAGACGACTCCAAGAAGGAGCAGGGTTTTTCCGATGGTTCCGAGAGTGCAAGAGCTGGAAGTAAA
ACCCCTCCTCACTACAACAAACGGAAAGAAACTCAAACTCTCAGCCATGATATCACCAAATTCGTGAAAATGGAT
CTCAACATCAACGGTCATAACGAACAACTGGATGCGGTCGTCACTCCCTTACAATCATCCGACCTCTTTCTAGGC
CATGATTGGTTAACAAACCACAACCCCGAGATTGATTGGAAACAAGGTATAATCAAATTCAACCGGTGCCCCACA
TCATGTTCTTTTCCCCATACCGACATTTCTTTCGAACCACGTATACGACGATTACAGTCTAACGAAGACACTGAG
GAAAAAGAACCGGATCCAACGAACCCAGAGGACTTACCAGCATACATGAAACCCTTCGCCCATCTTTTCAACAAA
AAGAATTTCGACAAACTCCCTGAACGGACAGAATGGGATCACGAAATCAACTTCACGGAAAACGCACCTACGGAA
ATATCATCAAAGGTTTATAGCATGACGCCATTGGAGAGAGAAGAACTGGACAAATTTTTGGATGAAAACCTGGCC
ACCAATCGAATCCGACCATCAAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGTTCATTA
CGGTTATGTCAGGATTATAGGAAACTGAACGACATCACGATCAAGGACAAGACACCACTACCTCTCATCAGCGAA
GTATTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGATATTATCTGGGGATATAACAACGTTCGGATA
CGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAATCGAGGATTATTTGAACCAACAGTCATGTTCTTCGGA
ATGAGTAATTCCCCTGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAAGACGGATCCCTA
GCCAACTACATGGACGATTTTATCATCCCAGCAAAAGACGAGGAAGAATTAGAAGCACGAACTATACGTTTCCTC
AAAATGGCGGAGAAACACAATCTATCATTCAAACGAACGAAATGCGAGTTCAATGTCTCATCAACAACGGTGTTG
GGAACAGTTATTGGGAATGGAAAGGCAACAATGGAAGAGGAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCT
ACCACGGTCAAACAAGTCGAAAGCTTTTTAGGCTTTGCGAATTTCTATCGACGCTTTATCAAGAATTTCAGCACC
ATCGCACAACCACTAAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAACGATGAACAACAACAAGCT
TTCGAACAAATCAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAAGGACAATTCAGAGTC
GAAGTAGACGCATCGAACTATGGAACAGGAGCAGTACTATCACAGAAACAGGAAAACAAATGGCACCCGGTCGCT
TTCATGTCGAAAACATTATCAGAAGCCGAAAGAAACTACGAAATCTATGACAAGGAACTACTAGCCATCATAAAA
GCTTTGAAATTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACAGATCACGAGAACCTC
AAGTATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATACGACTTT
CTTCTACGACACATTCCTGGGAAGACTAACACCAAAGCAGACATCCTGTCAAGACTAATTAAACCCGACACATCT
AACGACAACCGAGGAGTAGAAATGTTCAAAGAGAAGATGTTTATCCGAAGGCTTGAAGAATCCACCCCCATCTAT
GACGTCACCTTACTCCACAATCGAAGATTCGAGATTTTAGCCGACAAAACCGTACTTGAGAAGATCAGGAAATGT
GAAAGACGAGAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAGAACAAAGGAATCATT
TACCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCACGATCATCATAATTCC
CCCGACGCCGGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGGTGGCCTACGATCAAA
ACGGATATCAGAAGATATGTCAAAGGATGCGACATGTGCCAGAAGAACAAAACGATTAGACGACCCGATCACATT
CCGCTTAACCCATTACCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATTGGACCACTACCGAAG
TCAAAGGAGAAGGATGCTATTATTGTTATCGTTGACAGATTTTCCAAAATGATCCACCTCGTTCCCACTACCACG
TCACTCACGTCCATGGATCTTGCGGAAATCTATAAGGAAGAAGTCTGGCGACATCACGGAATTCCGAAACGGATT
ATTAGCAACAGAGGACCACAATTTGCATCGAAATTTATGGAATCACTATGCAAAGCGCTAGGCATTGAACGAAAC
CTTTCTACGGCCTACCACCCACAAACAGACGGACAAACAGAACGGATGAATCAGGAAATCGAGACCTACCTTCGA
GCATTCATCAATTATCGACAAGACGATTGGACGAGATGGCTTCCCATGGCAGAATTCCATTACAACGACAAAACC
CACGCTGCCACCGGACAAACCCCATTCTTCTTAAACTACGGACTTCACCCATGGAAGGGTAATATCACGGTTGAA
ACGACGAACCCCACCGCCACCTCCCTGATCGAAGAATTAGAGAACGTGCGAGAAGAAGCTAAAGCTGCGATGGAA
ATAAACAACGAAATGATGAGAGAAAGAGGAAACAACAAGCACCACAAAGAACCCTTTGCCAAAGGAGATAGAGTT
TGGTTAGAAACGACAAACATTCATTCCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCTTTTGAG
ATCTTGAAACAAATCGGCGATCGATCTTACAAACTGAAGTTACCTGATACCTGGGCGATACACGACGTCTTTCAT
ACATCGCTTCTAACAAAAGTCCGAGACCCAGAGTTTAACAGTCAAAAGAAACCCACTCCACCTCCACCTGACATT
ATCAATGAAGAAGAAGAATACGAAGTTGAAGAAATCCGAGGACATCGACGAAGAGGCCGAGGAATACAATTTTTA
GTTCACTGGAAGGGATATGGAAACGAAGATGATTCTTGGATACCACAATCATCTTTGGAAAATGCAGAAGAAGCA
CTCTCCGAATACAAAGCAAAACTTCCCAATGGAAAGCTATAA
Transcript >Agabi119p4|643250
ATGAGCACAGAGAGAAACGACTACGACAGTCTAGACGAAGAACACTACGAACGAGTAGCCAGATCTACTAGGAGG
AACCAGAACAGGAAGAACCAGAAGAAACGACACCAGGTTGATTTTAGGAGTTACCGAGACACTAGGAACATCGAC
ACAGAGTCAGAGAACGAGAATACCATCGACACAGACGATCAAAACAACCGAGACAACAACAACATGAGCAACGAC
GCCGCCGTAACCGTTAGTGCACAGACAGATGCACTCAAATCGCTTATCCCGAACCCGAAGGATTTTGGGGGGAAT
AGAGAGCAGTTTTCAGAATGGTGGAGGAGCATGACGCTTTTCCTCAAGTACAACAAAGTCACGGACACCGACCAG
AAGATTATCGCTACCATCGTACGATTGAAAGGACCAGTCCCCAGCTGTTTTGCCGACATATGGACAGAAAAAATC
GCCACCAACTTCACATACACTTGGGATACTTTTGAAGAAGAACTCAAGACTTCATTTGGAAAGGGAAACGAGAAG
GATATAGCAGAAGAAAGGATTGAATCCCTCAAACAAGGAAACAGGAACACCATGGACTTCCTAGTCGAATTCACA
GCTCTCATGTACAAAGCCAAAATCGATGACCAACACGCCATATTCCTCCTTAAACGCCACACTCGTCACGACATT
ATCAAAACGATCTTAGGATATCCAAGTAAAGACATTCCGAAGTCGAGAGAAGACTGGAATAACGCAATTCTACAA
GTTGGGTCAGGATTAGAGACGATGAAAAGGATTGATCAGAAGACCGATACTGGAATCACTTACGGAGGAAGTGGA
CAACCAATGGAGATAGGATGGAAGAAATTCGAATGGGACAAGGATGGAAAACCCAAATGTCACAAATGCGGAAAG
TTCGGACACATCGGGAAGAACTGCGAAGAGAAGAGGAAGAATTTTGGAGAGAGGAAGAACTTCAAGTGTTTCAGT
TGTGGGAAATTTGGACACATTGCGAAGGATTGTCGAAGCAACAGGAGTGGAAGGATTAGAGCAATGAACGAGGAT
TCTGACGATGAAGACGACTCCAAGAAGGAGCAGGGTTTTTCCGATGGTTCCGAGAGTGCAAGAGCTGGAAGTAAA
ACCCCTCCTCACTACAACAAACGGAAAGAAACTCAAACTCTCAGCCATGATATCACCAAATTCGTGAAAATGGAT
CTCAACATCAACGGTCATAACGAACAACTGGATGCGGTCGTCACTCCCTTACAATCATCCGACCTCTTTCTAGGC
CATGATTGGTTAACAAACCACAACCCCGAGATTGATTGGAAACAAGGTATAATCAAATTCAACCGGTGCCCCACA
TCATGTTCTTTTCCCCATACCGACATTTCTTTCGAACCACGTATACGACGATTACAGTCTAACGAAGACACTGAG
GAAAAAGAACCGGATCCAACGAACCCAGAGGACTTACCAGCATACATGAAACCCTTCGCCCATCTTTTCAACAAA
AAGAATTTCGACAAACTCCCTGAACGGACAGAATGGGATCACGAAATCAACTTCACGGAAAACGCACCTACGGAA
ATATCATCAAAGGTTTATAGCATGACGCCATTGGAGAGAGAAGAACTGGACAAATTTTTGGATGAAAACCTGGCC
ACCAATCGAATCCGACCATCAAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGTTCATTA
CGGTTATGTCAGGATTATAGGAAACTGAACGACATCACGATCAAGGACAAGACACCACTACCTCTCATCAGCGAA
GTATTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGATATTATCTGGGGATATAACAACGTTCGGATA
CGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAATCGAGGATTATTTGAACCAACAGTCATGTTCTTCGGA
ATGAGTAATTCCCCTGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAAGACGGATCCCTA
GCCAACTACATGGACGATTTTATCATCCCAGCAAAAGACGAGGAAGAATTAGAAGCACGAACTATACGTTTCCTC
AAAATGGCGGAGAAACACAATCTATCATTCAAACGAACGAAATGCGAGTTCAATGTCTCATCAACAACGGTGTTG
GGAACAGTTATTGGGAATGGAAAGGCAACAATGGAAGAGGAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCT
ACCACGGTCAAACAAGTCGAAAGCTTTTTAGGCTTTGCGAATTTCTATCGACGCTTTATCAAGAATTTCAGCACC
ATCGCACAACCACTAAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAACGATGAACAACAACAAGCT
TTCGAACAAATCAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAAGGACAATTCAGAGTC
GAAGTAGACGCATCGAACTATGGAACAGGAGCAGTACTATCACAGAAACAGGAAAACAAATGGCACCCGGTCGCT
TTCATGTCGAAAACATTATCAGAAGCCGAAAGAAACTACGAAATCTATGACAAGGAACTACTAGCCATCATAAAA
GCTTTGAAATTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACAGATCACGAGAACCTC
AAGTATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATACGACTTT
CTTCTACGACACATTCCTGGGAAGACTAACACCAAAGCAGACATCCTGTCAAGACTAATTAAACCCGACACATCT
AACGACAACCGAGGAGTAGAAATGTTCAAAGAGAAGATGTTTATCCGAAGGCTTGAAGAATCCACCCCCATCTAT
GACGTCACCTTACTCCACAATCGAAGATTCGAGATTTTAGCCGACAAAACCGTACTTGAGAAGATCAGGAAATGT
GAAAGACGAGAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAGAACAAAGGAATCATT
TACCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCACGATCATCATAATTCC
CCCGACGCCGGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGGTGGCCTACGATCAAA
ACGGATATCAGAAGATATGTCAAAGGATGCGACATGTGCCAGAAGAACAAAACGATTAGACGACCCGATCACATT
CCGCTTAACCCATTACCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATTGGACCACTACCGAAG
TCAAAGGAGAAGGATGCTATTATTGTTATCGTTGACAGATTTTCCAAAATGATCCACCTCGTTCCCACTACCACG
TCACTCACGTCCATGGATCTTGCGGAAATCTATAAGGAAGAAGTCTGGCGACATCACGGAATTCCGAAACGGATT
ATTAGCAACAGAGGACCACAATTTGCATCGAAATTTATGGAATCACTATGCAAAGCGCTAGGCATTGAACGAAAC
CTTTCTACGGCCTACCACCCACAAACAGACGGACAAACAGAACGGATGAATCAGGAAATCGAGACCTACCTTCGA
GCATTCATCAATTATCGACAAGACGATTGGACGAGATGGCTTCCCATGGCAGAATTCCATTACAACGACAAAACC
CACGCTGCCACCGGACAAACCCCATTCTTCTTAAACTACGGACTTCACCCATGGAAGGGTAATATCACGGTTGAA
ACGACGAACCCCACCGCCACCTCCCTGATCGAAGAATTAGAGAACGTGCGAGAAGAAGCTAAAGCTGCGATGGAA
ATAAACAACGAAATGATGAGAGAAAGAGGAAACAACAAGCACCACAAAGAACCCTTTGCCAAAGGAGATAGAGTT
TGGTTAGAAACGACAAACATTCATTCCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCTTTTGAG
ATCTTGAAACAAATCGGCGATCGATCTTACAAACTGAAGTTACCTGATACCTGGGCGATACACGACGTCTTTCAT
ACATCGCTTCTAACAAAAGTCCGAGACCCAGAGTTTAACAGTCAAAAGAAACCCACTCCACCTCCACCTGACATT
ATCAATGAAGAAGAAGAATACGAAGTTGAAGAAATCCGAGGACATCGACGAAGAGGCCGAGGAATACAATTTTTA
GTTCACTGGAAGGGATATGGAAACGAAGATGATTCTTGGATACCACAATCATCTTTGGAAAATGCAGAAGAAGCA
CTCTCCGAATACAAAGCAAAACTTCCCAATGGAAAGCTATAA
Gene >Agabi119p4|643250
ATGAGCACAGAGAGAAACGACTACGACAGTCTAGACGAAGAACACTACGAACGAGTAGCCAGATCTACTAGGAGG
AACCAGAACAGGAAGAACCAGAAGAAACGACACCAGGTTGATTTTAGGAGTTACCGAGACACTAGGAACATCGAC
ACAGAGTCAGAGAACGAGAATACCATCGACACAGACGATCAAAACAACCGAGACAACAACAACATGAGCAACGAC
GCCGCCGTAACCGTTAGTGCACAGACAGATGCACTCAAATCGCTTATCCCGAACCCGAAGGATTTTGGGGGGAAT
AGAGAGCAGTTTTCAGAATGGTGGAGGAGCATGACGCTTTTCCTCAAGTACAACAAAGTCACGGACACCGACCAG
AAGATTATCGCTACCATCGTACGATTGAAAGGACCAGTCCCCAGCTGTTTTGCCGACATATGGACAGAAAAAATC
GCCACCAACTTCACATACACTTGGGATACTTTTGAAGAAGAACTCAAGACTTCATTTGGAAAGGGAAACGAGAAG
GATATAGCAGAAGAAAGGATTGAATCCCTCAAACAAGGAAACAGGAACACCATGGACTTCCTAGTCGAATTCACA
GCTCTCATGTACAAAGCCAAAATCGATGACCAACACGCCATATTCCTCCTTAAACGCCACACTCGTCACGACATT
ATCAAAACGATCTTAGGATATCCAAGTAAAGACATTCCGAAGTCGAGAGAAGACTGGAATAACGCAATTCTACAA
GTTGGGTCAGGATTAGAGACGATGAAAAGGATTGATCAGAAGACCGATACTGGAATCACTTACGGAGGAAGTGGA
CAACCAATGGAGATAGGATGGAAGAAATTCGAATGGGACAAGGATGGAAAACCCAAATGTCACAAATGCGGAAAG
TTCGGACACATCGGGAAGAACTGCGAAGAGAAGAGGAAGAATTTTGGAGAGAGGAAGAACTTCAAGTGTTTCAGT
TGTGGGAAATTTGGACACATTGCGAAGGATTGTCGAAGCAACAGGAGTGGAAGGATTAGAGCAATGAACGAGGAT
TCTGACGATGAAGACGACTCCAAGAAGGAGCAGGGTTTTTCCGATGGTTCCGAGTAGGCACGACCTCGCGAACCA
ATGTACCTAGACAAATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAGCTGGAAGTAAAAC
CCCTCCTCACTACAACAAACGGAAAGAAACTCAAACTCTCAGCCATGATATCACCAAATTCGTGAAAATGGATCT
CAACATCAACGGTCATAACGAACAACTGGATGCGGTCGTCACTCCCTTACAATCATCCGACCTCTTTCTAGGCCA
TGATTGGTTAACAAACCACAACCCCGAGATTGATTGGAAACAAGGTATAATCAAATTCAACCGGTGCCCCACATC
ATGTTCTTTTCCCCATACCGACATTTCTTTCGAACCACGTATACGACGATTACAGTCTAACGAAGACACTGAGGA
AAAAGAACCGGATCCAACGAACCCAGAGGACTTACCAGCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAA
GAATTTCGACAAACTCCCTGAACGGACAGAATGGGATCACGAAATCAACTTCACGGAAAACGCACCTACGGAAAT
ATCATCAAAGGTTTATAGCATGACGCCATTGGAGAGAGAAGAACTGGACAAATTTTTGGATGAAAACCTGGCCAC
CAATCGAATCCGACCATCAAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGTTCATTACG
GTTATGTCAGGATTATAGGAAACTGAACGACATCACGATCAAGGACAAGACACCACTACCTCTCATCAGCGAAGT
ATTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGATATTATCTGGGGATATAACAACGTTCGGATACG
AGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAATCGAGGATTATTTGAACCAACAGTCATGTTCTTCGGAAT
GAGTAATTCCCCTGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAAGACGGATCCCTAGC
CAACTACATGGACGATTTTATCATCCCAGCAAAAGACGAGGAAGAATTAGAAGCACGAACTATACGTTTCCTCAA
AATGGCGGAGAAACACAATCTATCATTCAAACGAACGAAATGCGAGTTCAATGTCTCATCAACAACGGTGTTGGG
AACAGTTATTGGGAATGGAAAGGCAACAATGGAAGAGGAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTAC
CACGGTCAAACAAGTCGAAAGCTTTTTAGGCTTTGCGAATTTCTATCGACGCTTTATCAAGAATTTCAGCACCAT
CGCACAACCACTAAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAACGATGAACAACAACAAGCTTT
CGAACAAATCAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAAGGACAATTCAGAGTCGA
AGTAGACGCATCGAACTATGGAACAGGAGCAGTACTATCACAGAAACAGGAAAACAAATGGCACCCGGTCGCTTT
CATGTCGAAAACATTATCAGAAGCCGAAAGAAACTACGAAATCTATGACAAGGAACTACTAGCCATCATAAAAGC
TTTGAAATTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACAGATCACGAGAACCTCAA
GTATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATACGACTTTCT
TCTACGACACATTCCTGGGAAGACTAACACCAAAGCAGACATCCTGTCAAGACTAATTAAACCCGACACATCTAA
CGACAACCGAGGAGTAGAAATGTTCAAAGAGAAGATGTTTATCCGAAGGCTTGAAGAATCCACCCCCATCTATGA
CGTCACCTTACTCCACAATCGAAGATTCGAGATTTTAGCCGACAAAACCGTACTTGAGAAGATCAGGAAATGTGA
AAGACGAGAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAGAACAAAGGAATCATTTA
CCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCACGATCATCATAATTCCCC
CGACGCCGGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGGTGGCCTACGATCAAAAC
GGATATCAGAAGATATGTCAAAGGATGCGACATGTGCCAGAAGAACAAAACGATTAGACGACCCGATCACATTCC
GCTTAACCCATTACCCATCCCCGACAAACCTTGGGAAGAAATATCTATAGACATGATTGGACCACTACCGAAGTC
AAAGGAGAAGGATGCTATTATTGTTATCGTTGACAGATTTTCCAAAATGATCCACCTCGTTCCCACTACCACGTC
ACTCACGTCCATGGATCTTGCGGAAATCTATAAGGAAGAAGTCTGGCGACATCACGGAATTCCGAAACGGATTAT
TAGCAACAGAGGACCACAATTTGCATCGAAATTTATGGAATCACTATGCAAAGCGCTAGGCATTGAACGAAACCT
TTCTACGGCCTACCACCCACAAACAGACGGACAAACAGAACGGATGAATCAGGAAATCGAGACCTACCTTCGAGC
ATTCATCAATTATCGACAAGACGATTGGACGAGATGGCTTCCCATGGCAGAATTCCATTACAACGACAAAACCCA
CGCTGCCACCGGACAAACCCCATTCTTCTTAAACTACGGACTTCACCCATGGAAGGGTAATATCACGGTTGAAAC
GACGAACCCCACCGCCACCTCCCTGATCGAAGAATTAGAGAACGTGCGAGAAGAAGCTAAAGCTGCGATGGAAAT
AAACAACGAAATGATGAGAGAAAGAGGAAACAACAAGCACCACAAAGAACCCTTTGCCAAAGGAGATAGAGTTTG
GTTAGAAACGACAAACATTCATTCCAATCGTCCGACTCGGAAACTAGACCACAAACGATATGGACCTTTTGAGAT
CTTGAAACAAATCGGCGATCGATCTTACAAACTGAAGTTACCTGATACCTGGGCGATACACGACGTCTTTCATAC
ATCGCTTCTAACAAAAGTCCGAGACCCAGAGTTTAACAGTCAAAAGAAACCCACTCCACCTCCACCTGACATTAT
CAATGAAGAAGAAGAATACGAAGTTGAAGAAATCCGAGGACATCGACGAAGAGGCCGAGGAATACAATTTTTAGT
TCACTGGAAGGGATATGGAAACGAAGATGATTCTTGGATACCACAATCATCTTTGGAAAATGCAGAAGAAGCACT
CTCCGAATACAAAGCAAAACTTCCCAATGGAAAGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail