Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|642000
Gene name
Locationscaffold_05a:955354..958576
Strand+
Gene length (bp)3222
Transcript length (bp)3222
Coding sequence length (bp)3222
Protein length (aa) 1074

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.3E-34 423 518
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 7.1E-33 448 554
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 2.0E-28 201 360
PF17921 Integrase_H2C2 Integrase zinc binding domain 1.3E-19 640 696
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 1.5E-15 1010 1068

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 90 983 3.0E-150
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 90 983 3.0E-150
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 90 983 3.0E-150
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 90 983 3.0E-150
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 90 983 3.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 90 983 3.0E-150
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 90 983 3.0E-150
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 90 983 3.0E-150
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 90 983 3.0E-150
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 90 983 3.0E-150
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 90 983 3.0E-150
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 90 983 3.0E-150
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 90 983 3.0E-150
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 90 983 1.0E-149
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 90 983 2.0E-149
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 90 983 2.0E-149
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 130 1069 4.0E-129
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 130 983 2.0E-128
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 134 796 3.0E-82
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 170 574 5.0E-73
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 169 576 5.0E-68
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 36 933 2.0E-61
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 125 574 3.0E-55
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 150 584 1.0E-39
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 226 562 4.0E-39
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 42 574 2.0E-38
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 90 574 2.0E-36
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 165 574 3.0E-36
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 90 574 4.0E-36
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 90 574 2.0E-35
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 165 572 4.0E-35
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 165 574 8.0E-35
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 153 494 2.0E-34
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 229 566 3.0E-34
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 147 494 2.0E-33
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 148 579 2.0E-33
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 30 575 3.0E-33
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 148 587 4.0E-33
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 148 587 5.0E-33
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 148 579 5.0E-33
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 148 587 5.0E-33
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 148 579 1.0E-32
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 185 574 1.0E-32
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 185 574 1.0E-32
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 148 579 2.0E-32
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 148 587 6.0E-32
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 157 574 7.0E-32
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 171 582 2.0E-31
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 148 587 1.0E-30
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 148 510 3.0E-30
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 148 510 5.0E-30
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 162 555 3.0E-26
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 165 585 4.0E-26
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 148 574 9.0E-25
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 643 955 1.0E-21
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 631 929 1.0E-21
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 330 453 2.0E-21
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 632 929 4.0E-21
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 558 919 4.0E-21
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 632 929 6.0E-21
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 153 562 8.0E-21
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 123 508 1.0E-20
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 650 900 3.0E-20
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 206 303 4.0E-20
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 153 562 8.0E-20
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 141 552 4.0E-19
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 558 975 2.0E-18
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 566 988 6.0E-17
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 558 975 2.0E-16
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 566 987 2.0E-16
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 631 873 2.0E-16
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 566 987 3.0E-16
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 193 408 3.0E-16
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 558 975 4.0E-16
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 631 873 4.0E-16
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 558 975 6.0E-16
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 621 985 1.0E-15
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 621 985 1.0E-15
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 141 415 1.0E-15
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 631 873 1.0E-15
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 621 985 2.0E-15
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 170 470 2.0E-14
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 631 873 7.0E-14
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 170 470 2.0E-13
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 631 873 2.0E-13
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 647 873 7.0E-13
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal a-particle MIA14 GN=pol PE=3 SV=1 156 491 1.0E-12
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 632 893 2.0E-12
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 733 985 4.0E-12
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 633 822 5.0E-12
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 156 365 1.0E-10
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 600 975 2.0E-10
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 631 981 4.0E-10
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 642 966 4.0E-10
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 380 493 1.0E-09
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 155 414 4.0E-09
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 121 427 5.0E-09
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 121 357 1.0E-08
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 155 414 1.0E-08
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 380 491 2.0E-08
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 635 983 2.0E-08
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 166 437 2.0E-08
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 155 414 2.0E-08
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 156 365 2.0E-08
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 164 432 3.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 158 394 4.0E-07
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 641 986 2.0E-06
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 160 470 2.0E-06
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 162 421 2.0E-06
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 160 470 2.0E-06
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 160 470 4.0E-06
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 124 365 5.0E-06
sp|P12894|POL_IPMAI Probable Pol polyprotein OS=Mouse intracisternal a-particle IL3 PE=3 SV=1 269 491 7.0E-06
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 162 421 8.0E-06
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 160 416 8.0E-06
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 160 470 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|642000
MNADGSRNASGVCTHYVLLNIEINNKKMLIQASIVSLGNHKLFLGISWLRKFNPAIDWTKQTLKWRDEDDDSTLT
LSRGPSSNFINNIFVEINSKSNTSQQLFNQAEKKKTESDPAKAVPKRFHKFLKVFNKVESEKLPPRRPWDHKIEV
QTDFKPKRMPVYNLTPIERKELDKFIAENLRKGYIRQSKSPMASSFFFVGKKGGDLRPCQDYRYLNQNTIKNAHP
IPNIARIMDKLKDSKWFTKLDVRLGYNNVRIHEGDEWKAAFRTPNGLYEPTVMFFGMTNSPATFQSMMDHIFKQL
IENGGVIIYMDDILIHTKTQKQLDELTKQVLQILEQNHLYLKTEKCEFETQRLEYLGVIITPDSIEMDPIKLKGI
EDWPVPKTVKNVRQFIGFCNFYRKFIHNYAKIAQPLNSLMRKTKKFEWNPNAQTAFETLKQQFLKRPVLQMVDQT
KPFEIECDASAFATGAVLLQRDTNGDKHPVAYYSKSLNPAERNYHVSDQEFLSIIRALKEWRHYVEGSPEPLLIW
SDHENLTRWKEPQQLNRRQARWMLYMTRFNYVIKHLPGNKNVLADALSRRPDLTPEGIDNENLIALPSTKFINFL
TEELEEKIKDKKDTITPSEQFTREEDIYTYQGRLVIPDDSDIKKELLTRVHDHESAGHPGIAETLRKLTKEVYWP
GMNTYVQNYVKGCPICQQYKINRHPLKPPMQPIKGPSVTKPFTQISMDLITDLPPSDGYDAILSIVDHGLTKGII
LTPTRKTATADDIAEMLIDKVFSKYGTPQKIISDRDPRFAAKSMQRLYEKLNIKPAFSTAYHPQTDGTTERYNQE
IEFYLAVYTSRNPNTWRRALPMIEFVHNTKPHAGRQHSPSELILGYNPKAFINKEESNVPSIEEKTLFLEQAREA
AIEAHEQARLKMANRSNRPWNALKVGDRVWLDNRNLPVPYASKKLSQRREGPFRVIRRTSPTTYELELPKRWKIH
NKFHASLLTPVVENDIYGKHNPQPPPTLVYGEEEYEVEAILNHRARKRRLGNGRLATRTEYLVRWQGYGPSEDSW
ESEEDLANSSEILEEYKNLKKLS*
Coding >Agabi119p4|642000
ATGAATGCCGATGGATCAAGAAATGCATCAGGAGTATGCACACACTATGTCCTACTCAACATCGAAATCAACAAC
AAGAAAATGTTGATACAAGCAAGCATAGTATCGCTTGGAAACCACAAACTATTCTTAGGAATATCATGGCTAAGA
AAATTCAATCCAGCAATAGATTGGACAAAACAAACTCTAAAATGGAGAGATGAAGATGACGACTCAACTCTTACA
CTTTCTAGAGGACCATCAAGCAACTTCATTAACAATATCTTCGTTGAAATCAACTCGAAAAGCAATACTTCACAA
CAGTTATTCAATCAAGCTGAAAAGAAGAAAACGGAATCTGATCCTGCTAAAGCAGTACCGAAAAGATTTCACAAG
TTTCTCAAAGTATTCAACAAAGTAGAATCAGAGAAATTACCACCAAGACGTCCTTGGGATCACAAAATTGAAGTT
CAAACCGACTTCAAACCCAAGAGAATGCCAGTCTACAATCTAACACCTATAGAACGAAAAGAATTAGACAAGTTC
ATAGCTGAAAACCTACGAAAGGGATACATCCGACAATCTAAATCACCAATGGCATCATCCTTCTTCTTTGTTGGA
AAGAAAGGAGGAGATCTACGCCCATGTCAAGATTATCGCTATCTTAATCAAAACACGATTAAGAATGCTCACCCT
ATTCCAAACATTGCTCGAATCATGGATAAACTAAAGGATTCGAAATGGTTTACAAAGCTAGATGTCAGACTAGGC
TATAACAATGTCAGAATTCATGAAGGAGATGAATGGAAAGCAGCATTCAGAACACCTAATGGATTATACGAGCCT
ACTGTCATGTTCTTTGGAATGACAAACTCGCCAGCCACATTTCAATCAATGATGGATCACATTTTCAAACAATTA
ATTGAAAATGGAGGAGTCATTATCTATATGGACGATATCTTAATCCATACAAAAACACAAAAACAACTTGATGAA
CTTACCAAACAAGTTCTTCAAATACTCGAACAAAACCATCTCTATCTCAAGACAGAGAAATGCGAATTTGAAACG
CAACGTCTAGAATACCTTGGAGTCATTATAACTCCAGATTCTATCGAAATGGATCCAATTAAACTGAAAGGAATT
GAAGATTGGCCTGTACCTAAAACGGTCAAGAATGTTCGACAATTCATTGGATTCTGCAACTTCTACAGAAAGTTC
ATTCACAATTACGCCAAAATCGCCCAACCTCTCAACTCTCTTATGAGGAAGACAAAGAAATTCGAATGGAATCCA
AATGCACAAACAGCATTTGAAACACTTAAACAACAATTCTTAAAACGACCAGTTCTACAAATGGTAGATCAAACC
AAACCATTTGAAATAGAATGCGATGCCTCCGCATTTGCCACAGGAGCAGTCTTACTACAACGAGACACCAATGGA
GATAAGCATCCGGTTGCTTATTACTCTAAATCCCTTAATCCAGCCGAAAGGAACTATCATGTTTCGGATCAGGAA
TTCTTATCAATCATTAGAGCATTAAAAGAATGGAGACACTATGTGGAAGGATCACCTGAACCATTACTAATTTGG
TCGGATCACGAGAACCTTACTCGGTGGAAGGAACCCCAACAATTAAACCGAAGACAAGCGAGATGGATGTTATAT
ATGACAAGATTCAATTATGTCATCAAACATCTTCCAGGCAATAAGAATGTCTTAGCCGATGCCCTGAGTAGACGT
CCAGATCTAACTCCAGAAGGCATAGATAACGAGAACTTAATTGCTCTACCTTCTACGAAGTTTATCAATTTCTTA
ACGGAAGAACTAGAAGAGAAGATCAAGGACAAGAAGGACACTATTACACCATCAGAGCAGTTTACTCGAGAAGAA
GACATCTATACTTATCAAGGAAGACTTGTGATACCGGATGACTCGGACATCAAGAAGGAACTCTTAACCCGAGTC
CATGATCATGAATCAGCTGGACACCCTGGAATAGCCGAAACACTTCGAAAATTAACGAAGGAAGTCTACTGGCCA
GGAATGAACACTTATGTCCAGAACTACGTCAAAGGATGCCCCATATGTCAACAATACAAGATCAACAGACATCCA
CTAAAACCGCCGATGCAACCGATCAAAGGACCTTCAGTAACGAAGCCATTTACACAAATATCTATGGATCTTATC
ACAGATCTACCCCCTAGTGATGGCTATGATGCAATATTGTCCATAGTGGACCATGGACTTACGAAAGGGATAATT
CTAACCCCTACTAGGAAAACAGCAACAGCTGATGACATCGCCGAAATGCTAATCGATAAGGTATTCTCTAAATAT
GGAACACCTCAGAAGATCATATCAGATCGAGACCCTCGATTCGCAGCCAAATCTATGCAAAGACTCTATGAAAAG
CTTAACATCAAGCCCGCATTTTCAACAGCTTATCATCCACAAACTGATGGAACTACAGAACGCTACAATCAAGAA
ATAGAATTTTATCTTGCAGTATATACTTCAAGAAACCCAAACACATGGAGACGAGCATTACCTATGATTGAATTC
GTTCACAATACTAAACCACATGCAGGAAGACAACACTCGCCTTCAGAACTTATATTAGGATACAATCCTAAAGCA
TTCATTAACAAAGAAGAATCAAATGTACCTTCTATCGAAGAGAAGACATTATTCTTAGAACAAGCTAGAGAAGCA
GCAATCGAAGCACATGAGCAAGCACGTTTGAAGATGGCTAACCGAAGTAACCGACCCTGGAATGCACTTAAGGTT
GGTGATAGAGTTTGGTTAGATAACCGAAACTTGCCCGTGCCGTACGCATCAAAGAAGCTCAGTCAAAGAAGAGAA
GGACCCTTCAGAGTAATTAGAAGAACTTCTCCCACAACATACGAGTTAGAACTTCCGAAGCGATGGAAGATACAC
AACAAATTCCATGCATCTCTGCTTACACCCGTAGTAGAGAATGACATCTATGGAAAGCATAATCCACAGCCACCT
CCGACATTAGTGTATGGAGAAGAGGAGTATGAAGTCGAAGCGATCCTTAATCACAGAGCAAGGAAGAGACGCTTG
GGAAATGGAAGACTCGCAACAAGAACAGAATATCTTGTCAGATGGCAAGGATATGGACCGTCAGAGGATTCATGG
GAATCGGAAGAAGATCTTGCGAATTCAAGCGAGATACTTGAAGAGTATAAGAACCTGAAGAAACTCAGCTAA
Transcript >Agabi119p4|642000
ATGAATGCCGATGGATCAAGAAATGCATCAGGAGTATGCACACACTATGTCCTACTCAACATCGAAATCAACAAC
AAGAAAATGTTGATACAAGCAAGCATAGTATCGCTTGGAAACCACAAACTATTCTTAGGAATATCATGGCTAAGA
AAATTCAATCCAGCAATAGATTGGACAAAACAAACTCTAAAATGGAGAGATGAAGATGACGACTCAACTCTTACA
CTTTCTAGAGGACCATCAAGCAACTTCATTAACAATATCTTCGTTGAAATCAACTCGAAAAGCAATACTTCACAA
CAGTTATTCAATCAAGCTGAAAAGAAGAAAACGGAATCTGATCCTGCTAAAGCAGTACCGAAAAGATTTCACAAG
TTTCTCAAAGTATTCAACAAAGTAGAATCAGAGAAATTACCACCAAGACGTCCTTGGGATCACAAAATTGAAGTT
CAAACCGACTTCAAACCCAAGAGAATGCCAGTCTACAATCTAACACCTATAGAACGAAAAGAATTAGACAAGTTC
ATAGCTGAAAACCTACGAAAGGGATACATCCGACAATCTAAATCACCAATGGCATCATCCTTCTTCTTTGTTGGA
AAGAAAGGAGGAGATCTACGCCCATGTCAAGATTATCGCTATCTTAATCAAAACACGATTAAGAATGCTCACCCT
ATTCCAAACATTGCTCGAATCATGGATAAACTAAAGGATTCGAAATGGTTTACAAAGCTAGATGTCAGACTAGGC
TATAACAATGTCAGAATTCATGAAGGAGATGAATGGAAAGCAGCATTCAGAACACCTAATGGATTATACGAGCCT
ACTGTCATGTTCTTTGGAATGACAAACTCGCCAGCCACATTTCAATCAATGATGGATCACATTTTCAAACAATTA
ATTGAAAATGGAGGAGTCATTATCTATATGGACGATATCTTAATCCATACAAAAACACAAAAACAACTTGATGAA
CTTACCAAACAAGTTCTTCAAATACTCGAACAAAACCATCTCTATCTCAAGACAGAGAAATGCGAATTTGAAACG
CAACGTCTAGAATACCTTGGAGTCATTATAACTCCAGATTCTATCGAAATGGATCCAATTAAACTGAAAGGAATT
GAAGATTGGCCTGTACCTAAAACGGTCAAGAATGTTCGACAATTCATTGGATTCTGCAACTTCTACAGAAAGTTC
ATTCACAATTACGCCAAAATCGCCCAACCTCTCAACTCTCTTATGAGGAAGACAAAGAAATTCGAATGGAATCCA
AATGCACAAACAGCATTTGAAACACTTAAACAACAATTCTTAAAACGACCAGTTCTACAAATGGTAGATCAAACC
AAACCATTTGAAATAGAATGCGATGCCTCCGCATTTGCCACAGGAGCAGTCTTACTACAACGAGACACCAATGGA
GATAAGCATCCGGTTGCTTATTACTCTAAATCCCTTAATCCAGCCGAAAGGAACTATCATGTTTCGGATCAGGAA
TTCTTATCAATCATTAGAGCATTAAAAGAATGGAGACACTATGTGGAAGGATCACCTGAACCATTACTAATTTGG
TCGGATCACGAGAACCTTACTCGGTGGAAGGAACCCCAACAATTAAACCGAAGACAAGCGAGATGGATGTTATAT
ATGACAAGATTCAATTATGTCATCAAACATCTTCCAGGCAATAAGAATGTCTTAGCCGATGCCCTGAGTAGACGT
CCAGATCTAACTCCAGAAGGCATAGATAACGAGAACTTAATTGCTCTACCTTCTACGAAGTTTATCAATTTCTTA
ACGGAAGAACTAGAAGAGAAGATCAAGGACAAGAAGGACACTATTACACCATCAGAGCAGTTTACTCGAGAAGAA
GACATCTATACTTATCAAGGAAGACTTGTGATACCGGATGACTCGGACATCAAGAAGGAACTCTTAACCCGAGTC
CATGATCATGAATCAGCTGGACACCCTGGAATAGCCGAAACACTTCGAAAATTAACGAAGGAAGTCTACTGGCCA
GGAATGAACACTTATGTCCAGAACTACGTCAAAGGATGCCCCATATGTCAACAATACAAGATCAACAGACATCCA
CTAAAACCGCCGATGCAACCGATCAAAGGACCTTCAGTAACGAAGCCATTTACACAAATATCTATGGATCTTATC
ACAGATCTACCCCCTAGTGATGGCTATGATGCAATATTGTCCATAGTGGACCATGGACTTACGAAAGGGATAATT
CTAACCCCTACTAGGAAAACAGCAACAGCTGATGACATCGCCGAAATGCTAATCGATAAGGTATTCTCTAAATAT
GGAACACCTCAGAAGATCATATCAGATCGAGACCCTCGATTCGCAGCCAAATCTATGCAAAGACTCTATGAAAAG
CTTAACATCAAGCCCGCATTTTCAACAGCTTATCATCCACAAACTGATGGAACTACAGAACGCTACAATCAAGAA
ATAGAATTTTATCTTGCAGTATATACTTCAAGAAACCCAAACACATGGAGACGAGCATTACCTATGATTGAATTC
GTTCACAATACTAAACCACATGCAGGAAGACAACACTCGCCTTCAGAACTTATATTAGGATACAATCCTAAAGCA
TTCATTAACAAAGAAGAATCAAATGTACCTTCTATCGAAGAGAAGACATTATTCTTAGAACAAGCTAGAGAAGCA
GCAATCGAAGCACATGAGCAAGCACGTTTGAAGATGGCTAACCGAAGTAACCGACCCTGGAATGCACTTAAGGTT
GGTGATAGAGTTTGGTTAGATAACCGAAACTTGCCCGTGCCGTACGCATCAAAGAAGCTCAGTCAAAGAAGAGAA
GGACCCTTCAGAGTAATTAGAAGAACTTCTCCCACAACATACGAGTTAGAACTTCCGAAGCGATGGAAGATACAC
AACAAATTCCATGCATCTCTGCTTACACCCGTAGTAGAGAATGACATCTATGGAAAGCATAATCCACAGCCACCT
CCGACATTAGTGTATGGAGAAGAGGAGTATGAAGTCGAAGCGATCCTTAATCACAGAGCAAGGAAGAGACGCTTG
GGAAATGGAAGACTCGCAACAAGAACAGAATATCTTGTCAGATGGCAAGGATATGGACCGTCAGAGGATTCATGG
GAATCGGAAGAAGATCTTGCGAATTCAAGCGAGATACTTGAAGAGTATAAGAACCTGAAGAAACTCAGCTAA
Gene >Agabi119p4|642000
ATGAATGCCGATGGATCAAGAAATGCATCAGGAGTATGCACACACTATGTCCTACTCAACATCGAAATCAACAAC
AAGAAAATGTTGATACAAGCAAGCATAGTATCGCTTGGAAACCACAAACTATTCTTAGGAATATCATGGCTAAGA
AAATTCAATCCAGCAATAGATTGGACAAAACAAACTCTAAAATGGAGAGATGAAGATGACGACTCAACTCTTACA
CTTTCTAGAGGACCATCAAGCAACTTCATTAACAATATCTTCGTTGAAATCAACTCGAAAAGCAATACTTCACAA
CAGTTATTCAATCAAGCTGAAAAGAAGAAAACGGAATCTGATCCTGCTAAAGCAGTACCGAAAAGATTTCACAAG
TTTCTCAAAGTATTCAACAAAGTAGAATCAGAGAAATTACCACCAAGACGTCCTTGGGATCACAAAATTGAAGTT
CAAACCGACTTCAAACCCAAGAGAATGCCAGTCTACAATCTAACACCTATAGAACGAAAAGAATTAGACAAGTTC
ATAGCTGAAAACCTACGAAAGGGATACATCCGACAATCTAAATCACCAATGGCATCATCCTTCTTCTTTGTTGGA
AAGAAAGGAGGAGATCTACGCCCATGTCAAGATTATCGCTATCTTAATCAAAACACGATTAAGAATGCTCACCCT
ATTCCAAACATTGCTCGAATCATGGATAAACTAAAGGATTCGAAATGGTTTACAAAGCTAGATGTCAGACTAGGC
TATAACAATGTCAGAATTCATGAAGGAGATGAATGGAAAGCAGCATTCAGAACACCTAATGGATTATACGAGCCT
ACTGTCATGTTCTTTGGAATGACAAACTCGCCAGCCACATTTCAATCAATGATGGATCACATTTTCAAACAATTA
ATTGAAAATGGAGGAGTCATTATCTATATGGACGATATCTTAATCCATACAAAAACACAAAAACAACTTGATGAA
CTTACCAAACAAGTTCTTCAAATACTCGAACAAAACCATCTCTATCTCAAGACAGAGAAATGCGAATTTGAAACG
CAACGTCTAGAATACCTTGGAGTCATTATAACTCCAGATTCTATCGAAATGGATCCAATTAAACTGAAAGGAATT
GAAGATTGGCCTGTACCTAAAACGGTCAAGAATGTTCGACAATTCATTGGATTCTGCAACTTCTACAGAAAGTTC
ATTCACAATTACGCCAAAATCGCCCAACCTCTCAACTCTCTTATGAGGAAGACAAAGAAATTCGAATGGAATCCA
AATGCACAAACAGCATTTGAAACACTTAAACAACAATTCTTAAAACGACCAGTTCTACAAATGGTAGATCAAACC
AAACCATTTGAAATAGAATGCGATGCCTCCGCATTTGCCACAGGAGCAGTCTTACTACAACGAGACACCAATGGA
GATAAGCATCCGGTTGCTTATTACTCTAAATCCCTTAATCCAGCCGAAAGGAACTATCATGTTTCGGATCAGGAA
TTCTTATCAATCATTAGAGCATTAAAAGAATGGAGACACTATGTGGAAGGATCACCTGAACCATTACTAATTTGG
TCGGATCACGAGAACCTTACTCGGTGGAAGGAACCCCAACAATTAAACCGAAGACAAGCGAGATGGATGTTATAT
ATGACAAGATTCAATTATGTCATCAAACATCTTCCAGGCAATAAGAATGTCTTAGCCGATGCCCTGAGTAGACGT
CCAGATCTAACTCCAGAAGGCATAGATAACGAGAACTTAATTGCTCTACCTTCTACGAAGTTTATCAATTTCTTA
ACGGAAGAACTAGAAGAGAAGATCAAGGACAAGAAGGACACTATTACACCATCAGAGCAGTTTACTCGAGAAGAA
GACATCTATACTTATCAAGGAAGACTTGTGATACCGGATGACTCGGACATCAAGAAGGAACTCTTAACCCGAGTC
CATGATCATGAATCAGCTGGACACCCTGGAATAGCCGAAACACTTCGAAAATTAACGAAGGAAGTCTACTGGCCA
GGAATGAACACTTATGTCCAGAACTACGTCAAAGGATGCCCCATATGTCAACAATACAAGATCAACAGACATCCA
CTAAAACCGCCGATGCAACCGATCAAAGGACCTTCAGTAACGAAGCCATTTACACAAATATCTATGGATCTTATC
ACAGATCTACCCCCTAGTGATGGCTATGATGCAATATTGTCCATAGTGGACCATGGACTTACGAAAGGGATAATT
CTAACCCCTACTAGGAAAACAGCAACAGCTGATGACATCGCCGAAATGCTAATCGATAAGGTATTCTCTAAATAT
GGAACACCTCAGAAGATCATATCAGATCGAGACCCTCGATTCGCAGCCAAATCTATGCAAAGACTCTATGAAAAG
CTTAACATCAAGCCCGCATTTTCAACAGCTTATCATCCACAAACTGATGGAACTACAGAACGCTACAATCAAGAA
ATAGAATTTTATCTTGCAGTATATACTTCAAGAAACCCAAACACATGGAGACGAGCATTACCTATGATTGAATTC
GTTCACAATACTAAACCACATGCAGGAAGACAACACTCGCCTTCAGAACTTATATTAGGATACAATCCTAAAGCA
TTCATTAACAAAGAAGAATCAAATGTACCTTCTATCGAAGAGAAGACATTATTCTTAGAACAAGCTAGAGAAGCA
GCAATCGAAGCACATGAGCAAGCACGTTTGAAGATGGCTAACCGAAGTAACCGACCCTGGAATGCACTTAAGGTT
GGTGATAGAGTTTGGTTAGATAACCGAAACTTGCCCGTGCCGTACGCATCAAAGAAGCTCAGTCAAAGAAGAGAA
GGACCCTTCAGAGTAATTAGAAGAACTTCTCCCACAACATACGAGTTAGAACTTCCGAAGCGATGGAAGATACAC
AACAAATTCCATGCATCTCTGCTTACACCCGTAGTAGAGAATGACATCTATGGAAAGCATAATCCACAGCCACCT
CCGACATTAGTGTATGGAGAAGAGGAGTATGAAGTCGAAGCGATCCTTAATCACAGAGCAAGGAAGAGACGCTTG
GGAAATGGAAGACTCGCAACAAGAACAGAATATCTTGTCAGATGGCAAGGATATGGACCGTCAGAGGATTCATGG
GAATCGGAAGAAGATCTTGCGAATTCAAGCGAGATACTTGAAGAGTATAAGAACCTGAAGAAACTCAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail