Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|641750
Gene name
Locationscaffold_05a:941955..943422
Strand+
Gene length (bp)1467
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 8.7E-38 143 245
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 9.9E-37 115 211
PF17921 Integrase_H2C2 Integrase zinc binding domain 7.8E-18 359 415

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 1 487 7.0E-78
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 1 487 7.0E-78
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 1 487 7.0E-78
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 1 487 7.0E-78
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 1 487 7.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 1 487 7.0E-78
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 1 487 7.0E-78
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 1 487 7.0E-78
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 1 487 7.0E-78
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 1 487 7.0E-78
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 1 487 7.0E-78
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 1 487 7.0E-78
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 1 487 7.0E-78
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 1 487 2.0E-77
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 1 487 2.0E-77
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 1 487 2.0E-77
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 1 482 6.0E-63
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 1 482 2.0E-62
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 1 467 5.0E-51
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 1 467 6.0E-51
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 1 266 4.0E-36
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 1 265 3.0E-34
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 1 266 1.0E-31
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 1 263 4.0E-21
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 1 265 1.0E-19
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 28 260 1.0E-18
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 27 260 3.0E-18
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 1 265 7.0E-18
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 1 265 6.0E-17
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 1 265 6.0E-17
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 22 164 9.0E-17
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 1 265 1.0E-16
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 1 265 2.0E-16
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 1 219 3.0E-16
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 345 481 7.0E-15
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 28 259 8.0E-15
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 1 271 1.0E-14
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 1 178 5.0E-14
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 48 265 5.0E-14
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 48 265 5.0E-14
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 1 195 5.0E-14
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 1 195 6.0E-14
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 1 195 6.0E-14
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 1 195 6.0E-14
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 1 246 7.0E-14
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 1 246 2.0E-13
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 1 195 3.0E-13
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 1 178 7.0E-13
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 1 178 7.0E-13
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 1 178 8.0E-13
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 1 299 8.0E-13
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 1 267 1.0E-12
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 316 470 2.0E-11
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 349 487 6.0E-11
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 71 184 1.0E-10
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 342 476 1.0E-10
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 1 200 3.0E-10
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 76 265 7.0E-10
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 1 265 8.0E-10
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 349 487 1.0E-09
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 350 482 1.0E-08
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 340 487 1.0E-08
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 349 487 1.0E-08
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 349 487 2.0E-08
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 349 469 2.0E-08
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 351 476 2.0E-08
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 286 469 3.0E-08
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 1 199 4.0E-08
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 350 482 4.0E-08
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 71 178 7.0E-08
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 366 487 4.0E-07
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 2 199 9.0E-07
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 1 199 6.0E-06
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 349 481 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|641750
MDDFIIPAKDDEELEARTIRFLKIAEQHNLSFKRTKCEFNVSSTTVLGTVIGNGKATMEEEKVKAIRDWAVPTMV
KQVESFLGFANFYRRFIKNFSTIAQPLNELKSKKGEKWYWKDEQQQAFEQIKQAIASEPVLALPKDKGQFRVEVD
ASNYGTGAVLSQEQENKWHSVAFMSKTLSEAERNYEIYDKELLAIIKALKLWRHYLLDAKEQFEIWTDHENLKYF
REPQKLNARQARWYLMLQEYDFLLRHIPGKTNTKADILSRLIKPDTSNDNRGVEMFKEKMFIRRLEESTPIYDVT
LLHNRRFEILADETVLEKIRKCERRETRVLEEMKKQPEKVWENKGIIYRQGRIYVPDNQEIRDFILHDHHNSPDA
RHPGTYRMLESVKRTFWWPTIKTDIRRYVRGCNMCQKNKTIPRPDHIPLNPLPIPDKPWEELSIDMIGPLPKSKE
KDAIIVIVDRFSKMIHLVPTTTTLTSMDLAEIYKEEIW*
Coding >Agabi119p4|641750
ATGGACGATTTTATTATTCCGGCAAAAGACGACGAAGAATTGGAAGCACGAACAATACGTTTCCTCAAAATCGCG
GAGCAACATAATCTATCATTCAAACGGACAAAATGCGAATTCAATGTCTCATCAACGACGGTATTAGGAACGGTT
ATCGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCATGGTC
AAACAAGTTGAAAGCTTCTTAGGCTTTGCGAATTTCTATCGACGTTTTATCAAGAATTTTAGCACCATAGCGCAA
CCACTGAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAAAGATGAACAACAACAAGCTTTCGAACAA
ATCAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAAGGACAGTTCAGAGTTGAAGTAGAC
GCATCAAACTATGGAACAGGAGCGGTACTATCACAGGAACAGGAAAACAAATGGCACTCGGTCGCTTTCATGTCG
AAAACATTATCAGAAGCCGAAAGAAACTACGAAATCTACGACAAGGAACTACTAGCCATCATAAAAGCTTTGAAA
TTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACAGATCACGAGAACCTCAAGTATTTC
CGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGTTACAGGAATACGACTTCCTTCTACGA
CACATCCCTGGGAAAACTAACACCAAAGCAGACATCCTGTCAAGACTAATTAAACCCGACACATCTAACGACAAC
CGAGGAGTAGAAATGTTCAAAGAGAAGATGTTTATCCGAAGGCTTGAAGAATCCACCCCCATCTATGATGTCACC
TTACTCCATAATCGAAGATTCGAGATTTTAGCCGATGAAACCGTACTTGAGAAGATTAGGAAATGTGAAAGACGA
GAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAGAACAAAGGAATCATTTACCGACAA
GGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCACGATCATCATAATTCCCCCGACGCC
AGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGGTGGCCTACGATCAAAACGGATATC
AGAAGATATGTCAGAGGATGCAACATGTGCCAGAAGAACAAAACGATTCCACGACCCGATCACATTCCGCTTAAC
CCATTACCCATCCCCGACAAACCTTGGGAAGAATTATCTATAGACATGATCGGACCACTACCGAAGTCAAAAGAG
AAGGATGCTATTATTGTTATCGTTGACAGATTTTCCAAAATGATCCACCTCGTTCCCACTACCACGACACTCACG
TCCATGGATCTTGCGGAAATCTATAAGGAAGAAATTTGGTGA
Transcript >Agabi119p4|641750
ATGGACGATTTTATTATTCCGGCAAAAGACGACGAAGAATTGGAAGCACGAACAATACGTTTCCTCAAAATCGCG
GAGCAACATAATCTATCATTCAAACGGACAAAATGCGAATTCAATGTCTCATCAACGACGGTATTAGGAACGGTT
ATCGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCATGGTC
AAACAAGTTGAAAGCTTCTTAGGCTTTGCGAATTTCTATCGACGTTTTATCAAGAATTTTAGCACCATAGCGCAA
CCACTGAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAAAGATGAACAACAACAAGCTTTCGAACAA
ATCAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAAGGACAGTTCAGAGTTGAAGTAGAC
GCATCAAACTATGGAACAGGAGCGGTACTATCACAGGAACAGGAAAACAAATGGCACTCGGTCGCTTTCATGTCG
AAAACATTATCAGAAGCCGAAAGAAACTACGAAATCTACGACAAGGAACTACTAGCCATCATAAAAGCTTTGAAA
TTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACAGATCACGAGAACCTCAAGTATTTC
CGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGTTACAGGAATACGACTTCCTTCTACGA
CACATCCCTGGGAAAACTAACACCAAAGCAGACATCCTGTCAAGACTAATTAAACCCGACACATCTAACGACAAC
CGAGGAGTAGAAATGTTCAAAGAGAAGATGTTTATCCGAAGGCTTGAAGAATCCACCCCCATCTATGATGTCACC
TTACTCCATAATCGAAGATTCGAGATTTTAGCCGATGAAACCGTACTTGAGAAGATTAGGAAATGTGAAAGACGA
GAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAGAACAAAGGAATCATTTACCGACAA
GGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCACGATCATCATAATTCCCCCGACGCC
AGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGGTGGCCTACGATCAAAACGGATATC
AGAAGATATGTCAGAGGATGCAACATGTGCCAGAAGAACAAAACGATTCCACGACCCGATCACATTCCGCTTAAC
CCATTACCCATCCCCGACAAACCTTGGGAAGAATTATCTATAGACATGATCGGACCACTACCGAAGTCAAAAGAG
AAGGATGCTATTATTGTTATCGTTGACAGATTTTCCAAAATGATCCACCTCGTTCCCACTACCACGACACTCACG
TCCATGGATCTTGCGGAAATCTATAAGGAAGAAATTTGGTGA
Gene >Agabi119p4|641750
ATGGACGATTTTATTATTCCGGCAAAAGACGACGAAGAATTGGAAGCACGAACAATACGTTTCCTCAAAATCGCG
GAGCAACATAATCTATCATTCAAACGGACAAAATGCGAATTCAATGTCTCATCAACGACGGTATTAGGAACGGTT
ATCGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCATGGTC
AAACAAGTTGAAAGCTTCTTAGGCTTTGCGAATTTCTATCGACGTTTTATCAAGAATTTTAGCACCATAGCGCAA
CCACTGAACGAGTTGAAGTCAAAAAAGGGAGAGAAATGGTATTGGAAAGATGAACAACAACAAGCTTTCGAACAA
ATCAAACAAGCTATCGCCAGTGAACCAGTCCTAGCACTACCAAAAGACAAAGGACAGTTCAGAGTTGAAGTAGAC
GCATCAAACTATGGAACAGGAGCGGTACTATCACAGGAACAGGAAAACAAATGGCACTCGGTCGCTTTCATGTCG
AAAACATTATCAGAAGCCGAAAGAAACTACGAAATCTACGACAAGGAACTACTAGCCATCATAAAAGCTTTGAAA
TTATGGCGACACTACCTATTGGATGCAAAGGAGCAGTTCGAGATATGGACAGATCACGAGAACCTCAAGTATTTC
CGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGTTACAGGAATACGACTTCCTTCTACGA
CACATCCCTGGGAAAACTAACACCAAAGCAGACATCCTGTCAAGACTAATTAAACCCGACACATCTAACGACAAC
CGAGGAGTAGAAATGTTCAAAGAGAAGATGTTTATCCGAAGGCTTGAAGAATCCACCCCCATCTATGATGTCACC
TTACTCCATAATCGAAGATTCGAGATTTTAGCCGATGAAACCGTACTTGAGAAGATTAGGAAATGTGAAAGACGA
GAAACCAGAGTATTAGAAGAGATGAAGAAGCAACCAGAGAAAGTATGGGAGAACAAAGGAATCATTTACCGACAA
GGAAGGATCTATGTTCCGGATAACCAGGAAATCAGAGATTTCATCCTTCACGATCATCATAATTCCCCCGACGCC
AGACATCCTGGAACATACCGAATGCTAGAATCAGTTAAACGAACCTTTTGGTGGCCTACGATCAAAACGGATATC
AGAAGATATGTCAGAGGATGCAACATGTGCCAGAAGAACAAAACGATTCCACGACCCGATCACATTCCGCTTAAC
CCATTACCCATCCCCGACAAACCTTGGGAAGAATTATCTATAGACATGATCGGACCACTACCGAAGTCAAAAGAG
AAGGATGCTATTATTGTTATCGTTGACAGATTTTCCAAAATGATCCACCTCGTTCCCACTACCACGACACTCACG
TCCATGGATCTTGCGGAAATCTATAAGGAAGAAATTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail