Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|639700
Gene name
Locationscaffold_05a:585833..587409
Strand-
Gene length (bp)1576
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08243 SPT2 SPT2 chromatin protein 4.1E-16 376 471

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94714|SPT2_SCHPO Protein spt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt2 PE=3 SV=1 346 441 1.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|639700
MSSFTALMALSASKTQEQNNLVERVKEERRKKELLQQKQRAEQEAKEREMEKKLRIKRFEEEKREEERRKRREEA
EKAREAAIQRKKDEQRDILLYGAKKAASSRASTSSSLAGSNGPKERRKGPDGNDDDSPSGLVLTREELRERRQQA
EMKRLYSSTRRSATAHSYSKAGRRLPGGAVDITTTSASPDTLSGKSVKDRITSMPNTLTKLNTVKRDTRTIDEIR
TDLQKKKEGKVLDGDEAKSFDDWFSTKKKEPIKKPHASSSIGSGANTPTSSAPPPPSNPSPSVKKLAAPPSSTAR
IPKISTAKSSMPKPYSQPSLKPTNGSQIGSLDKYHSSKGTYSHPAKGSKPYPIDRERDRNYSSKPNVNSAYMKKR
PRSESHSESPPPKRRAQSGDDEDLPGDISSEIWKLFGRKRDSYVAMDVFSDDEDMEADADALEREEMMSARIAKK
EDLEAFEAERRHEEEKRKRKKEKERLSRY*
Coding >Agabi119p4|639700
ATGTCGTCGTTCACGGCATTGATGGCGCTGAGTGCGTCCAAGACGCAGGAGCAGAATAATCTGGTCGAACGGGTC
AAAGAGGAGCGCCGGAAGAAAGAGCTACTCCAGCAAAAACAACGAGCGGAACAGGAGGCCAAAGAACGGGAAATG
GAGAAGAAGTTACGAATTAAACGTTTTGAAGAAGAGAAACGGGAAGAAGAGAGAAGAAAGAGGAGGGAAGAGGCT
GAGAAAGCTAGAGAGGCGGCTATCCAGCGTAAAAAGGACGAACAACGGGATATTTTACTCTATGGAGCCAAGAAG
GCTGCTTCCTCGAGGGCTTCTACATCCTCCTCACTGGCCGGCAGTAATGGTCCCAAGGAACGACGGAAGGGACCG
GACGGCAATGATGATGACTCACCTTCTGGTTTGGTACTCACGCGAGAAGAATTACGAGAAAGACGGCAGCAGGCT
GAGATGAAAAGGCTATACAGCTCAACGAGGAGGTCTGCGACTGCGCACTCTTATTCGAAAGCTGGGAGACGACTC
CCTGGCGGAGCAGTGGATATTACAACAACATCGGCAAGCCCCGATACGCTCTCCGGCAAGAGCGTAAAGGATCGG
ATCACTTCGATGCCCAACACCCTGACGAAACTGAATACGGTCAAGAGGGATACTAGGACTATCGATGAGATTAGG
ACCGACCTTCAGAAGAAGAAAGAGGGGAAAGTGTTGGATGGTGATGAGGCGAAGAGTTTTGATGATTGGTTTTCG
ACCAAGAAGAAGGAACCGATTAAGAAACCTCATGCTAGTTCTTCGATTGGTTCTGGTGCCAACACTCCGACGTCC
AGCGCTCCTCCTCCTCCATCAAACCCTTCTCCGTCGGTCAAGAAGCTCGCCGCACCTCCTTCATCTACTGCCAGA
ATACCCAAGATTTCCACGGCGAAGTCTTCCATGCCGAAACCATACTCTCAGCCAAGCTTGAAGCCGACAAATGGT
TCTCAAATTGGCTCACTCGACAAATATCACTCTAGCAAGGGCACATATTCGCATCCAGCCAAAGGTTCCAAGCCA
TATCCCATTGATCGTGAGAGAGACAGGAATTACTCTTCAAAACCGAACGTCAATTCTGCCTATATGAAAAAGCGG
CCAAGGTCTGAAAGTCACTCTGAGTCTCCTCCTCCGAAGAGGAGGGCCCAGTCTGGAGATGACGAAGATCTACCA
GGAGATATCAGCTCGGAAATTTGGAAATTATTTGGCCGAAAGAGGGATAGTTATGTCGCCATGGATGTATTCAGT
GACGATGAGGACATGGAAGCGGATGCTGATGCTCTTGAGCGGGAGGAAATGATGAGTGCTCGTATCGCGAAGAAG
GAAGATTTAGAAGCCTTCGAGGCGGAGCGGAGGCATGAAGAAGAGAAACGTAAACGCAAGAAGGAGAAAGAGCGG
CTCTCTCGCTATTGA
Transcript >Agabi119p4|639700
ATGTCGTCGTTCACGGCATTGATGGCGCTGAGTGCGTCCAAGACGCAGGAGCAGAATAATCTGGTCGAACGGGTC
AAAGAGGAGCGCCGGAAGAAAGAGCTACTCCAGCAAAAACAACGAGCGGAACAGGAGGCCAAAGAACGGGAAATG
GAGAAGAAGTTACGAATTAAACGTTTTGAAGAAGAGAAACGGGAAGAAGAGAGAAGAAAGAGGAGGGAAGAGGCT
GAGAAAGCTAGAGAGGCGGCTATCCAGCGTAAAAAGGACGAACAACGGGATATTTTACTCTATGGAGCCAAGAAG
GCTGCTTCCTCGAGGGCTTCTACATCCTCCTCACTGGCCGGCAGTAATGGTCCCAAGGAACGACGGAAGGGACCG
GACGGCAATGATGATGACTCACCTTCTGGTTTGGTACTCACGCGAGAAGAATTACGAGAAAGACGGCAGCAGGCT
GAGATGAAAAGGCTATACAGCTCAACGAGGAGGTCTGCGACTGCGCACTCTTATTCGAAAGCTGGGAGACGACTC
CCTGGCGGAGCAGTGGATATTACAACAACATCGGCAAGCCCCGATACGCTCTCCGGCAAGAGCGTAAAGGATCGG
ATCACTTCGATGCCCAACACCCTGACGAAACTGAATACGGTCAAGAGGGATACTAGGACTATCGATGAGATTAGG
ACCGACCTTCAGAAGAAGAAAGAGGGGAAAGTGTTGGATGGTGATGAGGCGAAGAGTTTTGATGATTGGTTTTCG
ACCAAGAAGAAGGAACCGATTAAGAAACCTCATGCTAGTTCTTCGATTGGTTCTGGTGCCAACACTCCGACGTCC
AGCGCTCCTCCTCCTCCATCAAACCCTTCTCCGTCGGTCAAGAAGCTCGCCGCACCTCCTTCATCTACTGCCAGA
ATACCCAAGATTTCCACGGCGAAGTCTTCCATGCCGAAACCATACTCTCAGCCAAGCTTGAAGCCGACAAATGGT
TCTCAAATTGGCTCACTCGACAAATATCACTCTAGCAAGGGCACATATTCGCATCCAGCCAAAGGTTCCAAGCCA
TATCCCATTGATCGTGAGAGAGACAGGAATTACTCTTCAAAACCGAACGTCAATTCTGCCTATATGAAAAAGCGG
CCAAGGTCTGAAAGTCACTCTGAGTCTCCTCCTCCGAAGAGGAGGGCCCAGTCTGGAGATGACGAAGATCTACCA
GGAGATATCAGCTCGGAAATTTGGAAATTATTTGGCCGAAAGAGGGATAGTTATGTCGCCATGGATGTATTCAGT
GACGATGAGGACATGGAAGCGGATGCTGATGCTCTTGAGCGGGAGGAAATGATGAGTGCTCGTATCGCGAAGAAG
GAAGATTTAGAAGCCTTCGAGGCGGAGCGGAGGCATGAAGAAGAGAAACGTAAACGCAAGAAGGAGAAAGAGCGG
CTCTCTCGCTATTGA
Gene >Agabi119p4|639700
ATGTCGTCGTTCACGGCATTGATGGCGCTGAGTGCGTCCAAGACGCAGGAGCAGAATAATCTGGTCGAACGGGTC
AAAGAGGAGCGCCGGAAGAAAGAGCTACTCCAGCAAAAACAACGAGCGGAACAGGAGGCCAAAGAACGGGAAATG
GAGAAGAAGTTACGAATTAAACGTTTTGAAGAAGAGAAACGGGAAGAAGAGAGAAGAAAGAGGAGGGAAGAGGCT
GAGAAAGCTAGAGAGGCGGCTATCCAGCGTAAAAAGGACGAACAACGGGATATTTTACTCTATGGAGCCAAGAAG
GCTGCTTCCTCGAGGGCTTCTACATCCTCCTCACTGGCCGGCAGTAATGGTCCCAAGGAACGACGGAAGGGACCG
GACGGCAATGATGATGACTCACCTTCTGGTTTGGTACTCACGCGAGAAGAATTACGAGAAAGACGGCAGCAGGCT
GAGATGAAAAGGCTATACAGCTCAACGAGGAGGTCTGCGACTGCGCACTCTTATTCGAAAGCTGGGAGACGACTC
CCTGGCGGAGCAGTGGATATTACAACAACATCGGCAAGCCCCGATACGCTCTCCGGCAAGAGCGTAAAGGATCGG
ATCACTTCGATGCCCAACACCCTGACGAAACTGAATACGGTCAAGAGGGATACTAGGACTATCGATGAGATTAGG
ACCGACCTTCAGAAGAAGAAAGAGGGGAAAGTGTTGGATGGTGATGAGGCGAAGAGTTTTGATGATTGGTTTTCG
ACCAAGAAGAAGGAACCGATTAAGAAACCTCATGCTAGTTCTTCGATTGGTTCTGGTGCCAACACTCCGACGTCC
AGTGAGCTGAACTTTTTCACTCTTTGGCGGTGGCAAGATACATGTTTGCTGATCGCTCTCGTGTAGGCGCTCCTC
CTCCTCCATCAAACCCTTCTCCGTCGGTCAAGAAGCTCGCCGCACCTCCTTCATCTACTGCCAGAATACCCAAGA
TTTCCACGGCGAAGTCTTCCATGCCGAAACCATACTCTCAGCCAAGCTTGAAGCCGACAAATGGTTCTCAAATTG
GCTCACTCGACAAATATCACTCTAGCAAGGGCACATATTCGCATCCAGCCAAAGGTTCCAAGCCATATCCCATTG
ATCGTGAGAGAGACAGGAATTACTCTTCAAAACCGAACGTCAATTCTGCCTATATGAAAAAGCGGCCAAGGTCTG
AAAGTCACTCTGAGTCTCCTCCTCCGAAGAGGAGGGCCCAGTCTGGAGATGACGAAGATCTACCAGGAGATATCA
GCTCGGAAATTTGGAAATTATTTGGCCGAAAGAGGGATAGTTATGTCGCCATGGATGTATTCAGTGACGATGAGG
ACATGGAAGCGGATGCTGATGCTCTTGAGCGGGAGGAAATGATGAGGTCTGTTGTTTCGCTGAAATGTGTTTATT
TGACAATCGCTGACAAAGTGGCCCTTTCGTTTCTCAATTCAGTGCTCGTATCGCGAAGAAGGAAGATTTAGAAGC
CTTCGAGGCGGAGCGGAGGCATGAAGAAGAGAAACGTAAACGCAAGAAGGAGAAAGAGCGGCTCTCTCGCTATTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail